DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAHbeta and BCA4

DIOPT Version :9

Sequence 1:NP_649849.1 Gene:CAHbeta / 41070 FlyBaseID:FBgn0037646 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_177198.1 Gene:BCA4 / 843377 AraportID:AT1G70410 Length:280 Species:Arabidopsis thaliana


Alignment Length:250 Identity:61/250 - (24%)
Similarity:100/250 - (40%) Gaps:61/250 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERILRGIMRYRNTTREQMVKE---FQKVRDNPEPKAVFFTCMDSRMIPTRYTDTHVGDMFVVRN 62
            :|||..|..:::.   |:.:|.   |..:.....||.:.|.|.|||:.|:...:...|:.|||||
plant    71 IERIKTGFTQFKT---EKYLKNSTLFNHLAKTQTPKFLVFACSDSRVCPSHILNFQPGEAFVVRN 132

  Fly    63 AGNLIPHAQHFQDEYFSCEPAALELGCVVNDIRHIIVCGHSDCKAMNLLYQLRD------PDFAS 121
            ..|::|   .|..:..|...||:|...|...:.:|:|.|||.|..:..|..:.|      .||  
plant   133 IANMVP---PFDQKRHSGVGAAVEYAVVHLKVENILVIGHSCCGGIKGLMSIEDDAAPTQSDF-- 192

  Fly   122 KLNRRLSPLRSWLCTHANTSLERFQEWRDAGMKDPLIFSSETPLRRFVAYIDEEQKFALEDKLSQ 186
                    :.:|:...|:...:..:|.:|                  ::|.|:..|...|    .
plant   193 --------IENWVKIGASARNKIKEEHKD------------------LSYDDQCNKCEKE----A 227

  Fly   187 INTLQQMSNIASYGFLKARLESHDLHIHA-----------LW-FDIYTGDIYYFS 229
            :|.  .:.|:.||.|::|.:..:.|.|..           || .|..|...:.||
plant   228 VNV--SLGNLLSYPFVRAEVVKNTLAIRGGHYNFVKGTFDLWELDFKTTPAFAFS 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAHbetaNP_649849.1 beta_CA_cladeB 7..228 CDD:238449 56/241 (23%)
BCA4NP_177198.1 PLN00416 23..280 CDD:177809 59/248 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4254
eggNOG 1 0.900 - - E1_COG0288
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I2509
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1136193at2759
OrthoFinder 1 1.000 - - FOG0003269
OrthoInspector 1 1.000 - - otm2985
orthoMCL 1 0.900 - - OOG6_100995
Panther 1 1.100 - - LDO PTHR11002
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.