DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAHbeta and BCA6

DIOPT Version :9

Sequence 1:NP_649849.1 Gene:CAHbeta / 41070 FlyBaseID:FBgn0037646 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001185259.1 Gene:BCA6 / 842185 AraportID:AT1G58180 Length:290 Species:Arabidopsis thaliana


Alignment Length:224 Identity:49/224 - (21%)
Similarity:95/224 - (42%) Gaps:52/224 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MRYR--NTTREQMVKEFQKVRD---NPEPKAVFFTCMDSRMIPTRYTDTHVGDMFVVRNAGNLIP 68
            ||:|  ...|::.:.|.:|.:.   ...||.:...|.|||:.|:.......|:.|.:||..||:.
plant    79 MRHRFLKFKRQKYLPEIEKFKALAIAQSPKVMVIGCADSRVCPSYVLGFQPGEAFTIRNVANLVT 143

  Fly    69 HAQHFQDEYFSCEPAALELGCVVNDIRHIIVCGHSDCKAMNLL--YQLRDPDFAS-----KLNRR 126
            ..|:...|..|    |||.......:.:|||.|||:|..:..|  :|......:|     .:|.:
plant   144 PVQNGPTETNS----ALEFAVTTLQVENIIVMGHSNCGGIAALMSHQNHQGQHSSLVERWVMNGK 204

  Fly   127 LSPLRSWLCTHANTSLERFQEWRDAGMKDPLIFSSETPLRRFVAYIDEEQKFALEDKLSQINTLQ 191
            .:.||:.|   |::.|...::.|:.                        :|.:::|         
plant   205 AAKLRTQL---ASSHLSFDEQCRNC------------------------EKESIKD--------- 233

  Fly   192 QMSNIASYGFLKARLESHDLHIHALWFDI 220
            .:.|:.:|.:::.|::..::.||..::::
plant   234 SVMNLITYSWIRDRVKRGEVKIHGCYYNL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAHbetaNP_649849.1 beta_CA_cladeB 7..228 CDD:238449 49/224 (22%)
BCA6NP_001185259.1 PLN02154 1..290 CDD:215111 49/224 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4254
eggNOG 1 0.900 - - E1_COG0288
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I2509
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1136193at2759
OrthoFinder 1 1.000 - - FOG0003269
OrthoInspector 1 1.000 - - otm2985
orthoMCL 1 0.900 - - OOG6_100995
Panther 1 1.100 - - O PTHR11002
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.