DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAHbeta and CA2

DIOPT Version :9

Sequence 1:NP_649849.1 Gene:CAHbeta / 41070 FlyBaseID:FBgn0037646 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_568303.2 Gene:CA2 / 831326 AraportID:AT5G14740 Length:331 Species:Arabidopsis thaliana


Alignment Length:228 Identity:54/228 - (23%)
Similarity:94/228 - (41%) Gaps:42/228 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERILRGIMRYRNTTREQMVKEFQKVRDNPEPKAVFFTCMDSRMIPTRYTDTHVGDMFVVRNAGN 65
            :|||..|.:.::....|.....:.::.....||.:.|.|.|||:.|:...|.|.||.|||||..|
plant   124 VERIKEGFVTFKKEKYETNPALYGELAKGQSPKYMVFACSDSRVCPSHVLDFHPGDAFVVRNIAN 188

  Fly    66 LIPHAQHFQDEYFSCEPAALELGCVVNDIRHIIVCGHSDCKAMNLLYQLRDPDFASKLNRRLSPL 130
            ::|   .|....::...||:|...:...:.:|:|.|||.|..:..|...              ||
plant   189 MVP---PFDKVKYAGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSF--------------PL 236

  Fly   131 RSWLCTHANTSLERFQEWRDAGMKDPLIFSSETPLRRFVAYIDEEQKFALEDKLSQ-----INTL 190
                  ..|.|.:..::|    :|..|...|:.        :.|.:..|.||:..:     :|. 
plant   237 ------DGNNSTDFIEDW----VKICLPAKSKV--------LAESESSAFEDQCGRCEREAVNV- 282

  Fly   191 QQMSNIASYGFLKARLESHDLHIHALWFDIYTG 223
             .::|:.:|.|::..:....|.:...::|...|
plant   283 -SLANLLTYPFVREGVVKGTLALKGGYYDFVNG 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAHbetaNP_649849.1 beta_CA_cladeB 7..228 CDD:238449 51/222 (23%)
CA2NP_568303.2 PLN03019 1..331 CDD:166660 54/228 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4254
eggNOG 1 0.900 - - E1_COG0288
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I2509
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1136193at2759
OrthoFinder 1 1.000 - - FOG0003269
OrthoInspector 1 1.000 - - otm2985
orthoMCL 1 0.900 - - OOG6_100995
Panther 1 1.100 - - O PTHR11002
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.