DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAHbeta and BCA5

DIOPT Version :9

Sequence 1:NP_649849.1 Gene:CAHbeta / 41070 FlyBaseID:FBgn0037646 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001031784.1 Gene:BCA5 / 829498 AraportID:AT4G33580 Length:302 Species:Arabidopsis thaliana


Alignment Length:224 Identity:53/224 - (23%)
Similarity:93/224 - (41%) Gaps:48/224 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KEFQKVRDNPEPKAVFFTCMDSRMIPTRYTDTHVGDMFVVRNAGNLIPHAQHFQDEYFSCEPAAL 85
            :.::.:.|...||.:...|.|||:.|:.......||.|.|||..||:|..:....|    ..|||
plant   103 EHYKNLADAQAPKFLVIACADSRVCPSAVLGFQPGDAFTVRNIANLVPPYESGPTE----TKAAL 163

  Fly    86 ELGCVVNDIRHIIVCGHSDCKAMNLLYQLRDPDFASKLNRRLSPLRSWLCTHANTSLERFQEWRD 150
            |......::.:|:|.|||.|..:..|.::.|.          ...||::           ..|..
plant   164 EFSVNTLNVENILVIGHSRCGGIQALMKMEDE----------GDSRSFI-----------HNWVV 207

  Fly   151 AGMKDPLIFSSETPLRRFVA---YIDEEQKFALEDKLSQINTLQQMSNIASYGFLKARLESHDLH 212
            .|.|     :.|:  .:.||   :.|.:.:..  :|.|..::|::   :..|.:::.::....|.
plant   208 VGKK-----AKES--TKAVASNLHFDHQCQHC--EKASINHSLER---LLGYPWIEEKVRQGSLS 260

  Fly   213 IHALW-------FDIYTGDIYYFSRGAKR 234
            :|..:       |:.:|.| |..|||.|:
plant   261 LHGGYYNFVDCTFEKWTVD-YAASRGKKK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAHbetaNP_649849.1 beta_CA_cladeB 7..228 CDD:238449 49/216 (23%)
BCA5NP_001031784.1 PLN03006 1..302 CDD:178583 53/224 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4254
eggNOG 1 0.900 - - E1_COG0288
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I2509
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1136193at2759
OrthoFinder 1 1.000 - - FOG0003269
OrthoInspector 1 1.000 - - otm2985
orthoMCL 1 0.900 - - OOG6_100995
Panther 1 1.100 - - O PTHR11002
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.