DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAHbeta and SPBP8B7.05c

DIOPT Version :9

Sequence 1:NP_649849.1 Gene:CAHbeta / 41070 FlyBaseID:FBgn0037646 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_596512.2 Gene:SPBP8B7.05c / 2541362 PomBaseID:SPBP8B7.05c Length:328 Species:Schizosaccharomyces pombe


Alignment Length:219 Identity:57/219 - (26%)
Similarity:89/219 - (40%) Gaps:45/219 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RNTTREQMVKE-----FQKVRDNPEPKAVFFTCMDSRMIPTRYTDTHVGDMFVVRNAGNLIPHAQ 71
            ||.|..|....     |...:|...|:.::..|.|||:..|...:...|::||.||..|::|.:.
pombe   131 RNLTWSQQTSRKYPSFFTATKDIQTPQVLWIGCSDSRVPETTILNLLPGEVFVHRNIANVVPRSD 195

  Fly    72 HFQDEYFSCEPAALELGCVVNDIRHIIVCGHSDCKAMNLLYQLRDPDFASKLNRRLSPLRSWLCT 136
                   ....|.:|....|..::|||||||..|..:           |:.|...|:.|......
pombe   196 -------INALAVMEYSVTVLKVKHIIVCGHYGCGGV-----------AAALGPNLNNLLDHWLR 242

  Fly   137 HANTSLERFQEWRDAGMKDPLIFSSETPLRRFVAYIDEEQKFALEDKLSQINTLQQMSNIASYGF 201
            |....:|..:|..|| ::||       .|||.              ||:::||..|..::...||
pombe   243 HIRDVIEDNREELDA-IEDP-------QLRRL--------------KLAELNTRAQAISVTRVGF 285

  Fly   202 LKARLESHDLHIHALWFDIYTGDI 225
            ::..:|...|.:|...:|:..|.|
pombe   286 VREAMEKRGLQVHGWIYDLSNGQI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAHbetaNP_649849.1 beta_CA_cladeB 7..228 CDD:238449 57/219 (26%)
SPBP8B7.05cNP_596512.2 PLN03019 1..307 CDD:166660 55/215 (26%)
beta_CA_cladeA 132..312 CDD:238448 56/218 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 58 1.000 Domainoid score I3096
eggNOG 1 0.900 - - E1_COG0288
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I1966
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003269
OrthoInspector 1 1.000 - - oto100551
orthoMCL 1 0.900 - - OOG6_100995
Panther 1 1.100 - - LDO PTHR11002
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16263
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.850

Return to query results.
Submit another query.