DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ich and ADR1

DIOPT Version :9

Sequence 1:NP_001262393.1 Gene:ich / 41069 FlyBaseID:FBgn0286204 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_010502.3 Gene:ADR1 / 851802 SGDID:S000002624 Length:1323 Species:Saccharomyces cerevisiae


Alignment Length:162 Identity:38/162 - (23%)
Similarity:63/162 - (38%) Gaps:31/162 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   439 SGLSLKDNGLCSPDLLGNYPHTTTASTTGSEMRTGAPKAKRSRSQKKS-------------NQQQ 490
            ||..:.|...|..:...|........|..|.:...:..|.|..|...|             |...
Yeast    11 SGFPVVDLNSCFSNGFNNEKQEIEMETDDSPILLMSSSASRENSNTFSVIQRTPDGKIITTNNNM 75

  Fly   491 QQQQQQQQQQGDGGGQPTTPQMSAISPSGFSASDLSGLLGKEKPVHRCSICNRGFLNKSNIKVHL 555
            ..:..:|..:     .|...:::..:|||...|.:            |.:|.|.|..:.::|.|.
Yeast    76 NSKINKQLDK-----LPENLRLNGRTPSGKLRSFV------------CEVCTRAFARQEHLKRHY 123

  Fly   556 RTHTGEKPFRCDVCAKAFRQKAHLLKH-QQIH 586
            |:||.|||:.|.:|.:.|.::..|::| |:||
Yeast   124 RSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIH 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ichNP_001262393.1 C2H2 Zn finger 538..558 CDD:275368 7/19 (37%)
zf-H2C2_2 550..575 CDD:316026 11/24 (46%)
C2H2 Zn finger 566..586 CDD:275368 6/20 (30%)
ADR1NP_010502.3 zf-C2H2 104..126 CDD:395048 7/33 (21%)
C2H2 Zn finger 106..126 CDD:275368 7/19 (37%)
zf-H2C2_2 118..143 CDD:404364 11/24 (46%)
C2H2 Zn finger 134..155 CDD:275368 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.