DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ich and CG7691

DIOPT Version :10

Sequence 1:NP_649848.2 Gene:ich / 41069 FlyBaseID:FBgn0286204 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_650728.1 Gene:CG7691 / 42228 FlyBaseID:FBgn0038626 Length:283 Species:Drosophila melanogaster


Alignment Length:144 Identity:35/144 - (24%)
Similarity:53/144 - (36%) Gaps:46/144 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 PHTTTASTTGSEMRTGAPKAKRSRSQKK----------SN-----QQQQQQQQQQQQQGDGGGQP 507
            |.|......|....|...|..|::.::|          ||     ..||::..::::....||| 
  Fly   125 PKTRNGIKVGIITVTAESKQTRTKLKRKGPILANVTVPSNIVEIPPIQQRKMPEKRRLKRVGGQ- 188

  Fly   508 TTPQMSAISPSGFSASDLSGLLGKEKPVHRCSICNRGFLNKSNIKVHLRTHTGEKPFRC--DVCA 570
                                        ..|..|::.|.:...:..|.|||||||||.|  ..|.
  Fly   189 ----------------------------FECIDCDKKFDHSWMLTAHTRTHTGEKPFVCPDGSCR 225

  Fly   571 KAFRQKAHLLKHQQ 584
            |||..:::|..||:
  Fly   226 KAFSDRSNLRSHQR 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ichNP_649848.2 zf-C2H2 536..558 CDD:395048 5/21 (24%)
C2H2 Zn finger 538..558 CDD:275368 5/19 (26%)
zf-H2C2_2 550..575 CDD:463886 15/26 (58%)
C2H2 Zn finger 566..586 CDD:275368 8/21 (38%)
CG7691NP_650728.1 COG5048 188..>271 CDD:227381 22/81 (27%)
C2H2 Zn finger 191..211 CDD:275368 5/19 (26%)
C2H2 Zn finger 219..244 CDD:275368 8/21 (38%)
C2H2 Zn finger 250..266 CDD:275368
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.