powered by:
Protein Alignment ich and CG1602
DIOPT Version :9
Sequence 1: | NP_001262393.1 |
Gene: | ich / 41069 |
FlyBaseID: | FBgn0286204 |
Length: | 592 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_610291.2 |
Gene: | CG1602 / 35684 |
FlyBaseID: | FBgn0033186 |
Length: | 577 |
Species: | Drosophila melanogaster |
Alignment Length: | 62 |
Identity: | 26/62 - (41%) |
Similarity: | 40/62 - (64%) |
Gaps: | 4/62 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 529 LGKEKPVHRCSICNRGFLNKSNIKVHLRTHTGEKPFRCDVCAKAFRQKAHLLKH-QQIHKRI 589
:|| .|:|:.|.|.|...|::::|:|||||.||:.|:.|.||||.::.:..| ..||.:|
Fly 419 IGK---THKCTHCERSFAVMSDLQLHIRTHTGHKPYVCEHCGKAFRLRSQMTLHVTAIHTKI 477
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR24393 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.