DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ich and CG1602

DIOPT Version :9

Sequence 1:	NP_001262393.1	Gene:	ich / 41069	FlyBaseID:	FBgn0286204	Length:	592	Species:	Drosophila melanogaster
Sequence 2:	NP_610291.2	Gene:	CG1602 / 35684	FlyBaseID:	FBgn0033186	Length:	577	Species:	Drosophila melanogaster

Alignment Length:	62	Identity:	26/62 - (41%)
Similarity:	40/62 - (64%)	Gaps:	4/62 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   529 LGKEKPVHRCSICNRGFLNKSNIKVHLRTHTGEKPFRCDVCAKAFRQKAHLLKH-QQIHKRI 589
            :||   .|:|:.|.|.|...|::::|:|||||.||:.|:.|.||||.::.:..| ..||.:|
  Fly   419 IGK---THKCTHCERSFAVMSDLQLHIRTHTGHKPYVCEHCGKAFRLRSQMTLHVTAIHTKI 477

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ich	NP_001262393.1	C2H2 Zn finger	538..558	CDD:275368	7/19 (37%)
		zf-H2C2_2	550..575	CDD:316026	13/24 (54%)
		C2H2 Zn finger	566..586	CDD:275368	7/20 (35%)
CG1602	NP_610291.2	GT1	157..244	CDD:304916
		MADF_DNA_bdg	273..356	CDD:287510
		C2H2 Zn finger	367..388	CDD:275368
		C2H2 Zn finger	397..418	CDD:275368
		COG5048	<423..554	CDD:227381	24/55 (44%)
		C2H2 Zn finger	425..445	CDD:275368	7/19 (37%)
		zf-H2C2_2	437..460	CDD:290200	11/22 (50%)
		C2H2 Zn finger	453..470	CDD:275368	6/16 (38%)
		C2H2 Zn finger	482..502	CDD:275368
		C2H2 Zn finger	510..530	CDD:275368
		C2H2 Zn finger	538..559	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24393
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100