DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ich and CG10348

DIOPT Version :9

Sequence 1:NP_001262393.1 Gene:ich / 41069 FlyBaseID:FBgn0286204 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster


Alignment Length:456 Identity:92/456 - (20%)
Similarity:145/456 - (31%) Gaps:167/456 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 LFADSQLDSKLYSVADSCVMNGSGSGSAANGNGSGPSIATLTPIDQVAD----------SLHNSG 237
            |...|.:....|.:|      .|.|.:|.:.:.:.|:..:.|...::..          :.|..|
  Fly    26 LIPTSYISHVPYDLA------SSASVAATSSSSTSPTTTSATTTGRLQHQHSHQQHQTLNHHAKG 84

  Fly   238 VR------------IYKDLTEYVDMNSIDDIAAIIGSAIADTTVPNQLDKDDNNDTRDSWMDLDA 290
            .|            .:|..|:.||...::|..:.:....::..|..|.:|:.||           
  Fly    85 KRRSSFDQPLDLRLAHKRKTDLVDQGPMEDENSNLIMFASELAVAQQKEKELNN----------- 138

  Fly   291 WIDGNCIQQESAKVLVSQQDSLGDFILPHSPLPMHASSSTLQSLLSHGYMPLLQNRLQNGPPNGN 355
                |.|..           ||.|       |....|...|::|                 ..|.
  Fly   139 ----NHIAA-----------SLAD-------LGFDMSRKMLRAL-----------------REGG 164

  Fly   356 SSGGGGGANQGAGIKGDPQAPTSTSYCNELAAATSSSCSPPGSVVSTTDNPNGLMINPRYLSNPT 420
            :.|||||...|.|..|.|.||          ..|...||.|.             ::|..|...|
  Fly   165 AGGGGGGGGGGGGGGGPPNAP----------PLTPPQCSIPA-------------VHPTLLEAMT 206

  Fly   421 NNQATGNLHQQGGYSMQASGLSLKDNGLCSPDLLG--NYPHTTTASTTGSEMRTGAPKAKRSRSQ 483
            .|                  |.|:...:.:..|.|  |.| ..::|.||::.....|..|...:.
  Fly   207 KN------------------LPLQYRNVFAGVLPGKVNSP-AASSSPTGADFPFRHPLKKCELTW 252

  Fly   484 KKSNQQQQ-----------------QQQQQQQQQGD--------GGGQPTTPQMSAISPSGFSAS 523
            ....:|.|                 |.|..|.::.:        |...|..||            
  Fly   253 PPPTEQLQLELPHPNPKLSPVLPHPQLQDYQTRRKNKARTAATGGNATPNLPQ------------ 305

  Fly   524 DLSGLLGKEKPVHRCSICNRGFLNKSNIKVHLRTHTGEKPFRCDVCAKAFRQKAHLLKH-QQIHK 587
                   :.|..:.|..|.:.|...:|:..||||||||:|::|..|.::|...::|.:| :.||.
  Fly   306 -------RNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHN 363

  Fly   588 R 588
            :
  Fly   364 K 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ichNP_001262393.1 C2H2 Zn finger 538..558 CDD:275368 7/19 (37%)
zf-H2C2_2 550..575 CDD:316026 13/24 (54%)
C2H2 Zn finger 566..586 CDD:275368 5/20 (25%)
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 23/81 (28%)
zf-C2H2 311..333 CDD:278523 7/21 (33%)
C2H2 Zn finger 313..333 CDD:275368 7/19 (37%)
zf-H2C2_2 325..349 CDD:290200 12/23 (52%)
C2H2 Zn finger 341..362 CDD:275368 5/20 (25%)
zf-H2C2_2 353..377 CDD:290200 4/12 (33%)
zf-C2H2 368..390 CDD:278523
C2H2 Zn finger 370..390 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.