DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ich and CG17328

DIOPT Version :9

Sequence 1:	NP_001262393.1	Gene:	ich / 41069	FlyBaseID:	FBgn0286204	Length:	592	Species:	Drosophila melanogaster
Sequence 2:	NP_609786.2	Gene:	CG17328 / 34962	FlyBaseID:	FBgn0028895	Length:	413	Species:	Drosophila melanogaster

Alignment Length:	116	Identity:	37/116 - (31%)
Similarity:	58/116 - (50%)	Gaps:	19/116 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly   478 KRSRSQKKSNQQQQQQQQQQQQQGDGGGQPTTPQMSAISPSGFSASDLSGLLGK-------EKPV 535
            :|||.|:|..::.:::           |....|:|.........:......|.:       |||
  Fly   122 RRSRYQRKPPEEHKKR-----------GPKPVPKMPHTCYECHKSFKCIAQLTQHIRTHTGEKP- 174

  Fly   536 HRCSICNRGFLNKSNIKVHLRTHTGEKPFRCDVCAKAFRQKAHLLKHQQIH 586
            ::||.|.:.|..|.|:|||.|||||:|||:|::|:|.|....:...||:||
  Fly   175 YQCSFCIQRFAQKYNLKVHERTHTGDKPFQCEICSKQFSALGNFQAHQKIH 225

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ich	NP_001262393.1	C2H2 Zn finger	538..558	CDD:275368	10/19 (53%)
		zf-H2C2_2	550..575	CDD:316026	16/24 (67%)
		C2H2 Zn finger	566..586	CDD:275368	6/19 (32%)
CG17328	NP_609786.2	zf-AD	8..80	CDD:214871
		COG5048	146..>211	CDD:227381	23/65 (35%)
		C2H2 Zn finger	149..169	CDD:275368	1/19 (5%)
		C2H2 Zn finger	177..197	CDD:275368	10/19 (53%)
		zf-H2C2_2	189..213	CDD:404364	15/23 (65%)
		C2H2 Zn finger	205..225	CDD:275368	6/19 (32%)
		C2H2 Zn finger	233..253	CDD:275368
		zf-H2C2_2	245..270	CDD:404364
		C2H2 Zn finger	261..282	CDD:275368
		C2H2 Zn finger	318..338	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24393
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100