DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ich and ztf-2

DIOPT Version :9

Sequence 1:NP_001262393.1 Gene:ich / 41069 FlyBaseID:FBgn0286204 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001379129.1 Gene:ztf-2 / 184429 WormBaseID:WBGene00008762 Length:360 Species:Caenorhabditis elegans


Alignment Length:137 Identity:32/137 - (23%)
Similarity:56/137 - (40%) Gaps:30/137 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   460 TTTASTTGSEMRTGAPKAKRSR------------SQKKSNQQQQQQQQQQQQQGDGGGQPTTPQM 512
            :|..||..|..:....|.:|..            ::|..:|..:::...:|:..:|.......:.
 Worm    13 STLLSTLSSPEKEHRRKRRRGEVANPSNTLDALVARKADDQPFEKRYLSEQEAIEGPDDEIEMKK 77

  Fly   513 SAISPSGFSASDLSGLLGKEKPVHRCSICNRGFLNK--SNIKVHLRTHTGEKPFRCDVCAKAFRQ 575
            ..:.|      |:|        ...||.|  |:..|  |.:..|.|.||.|:||:|..|::..:.
 Worm    78 MELDP------DVS--------TRTCSTC--GYQGKWVSEMIRHKRVHTSERPFKCRYCSRTSKW 126

  Fly   576 KAHLLKH 582
            ||.|::|
 Worm   127 KADLIRH 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ichNP_001262393.1 C2H2 Zn finger 538..558 CDD:275368 8/21 (38%)
zf-H2C2_2 550..575 CDD:316026 9/24 (38%)
C2H2 Zn finger 566..586 CDD:275368 6/17 (35%)
ztf-2NP_001379129.1 C2H2 Zn finger 89..109 CDD:275370 8/21 (38%)
zf-H2C2_5 115..139 CDD:404746 7/19 (37%)
C2H2 Zn finger 117..138 CDD:275370 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5275
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.