DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ich and odd-2

DIOPT Version :9

Sequence 1:	NP_001262393.1	Gene:	ich / 41069	FlyBaseID:	FBgn0286204	Length:	592	Species:	Drosophila melanogaster
Sequence 2:	NP_509032.1	Gene:	odd-2 / 183219	WormBaseID:	WBGene00003846	Length:	254	Species:	Caenorhabditis elegans

Alignment Length:	136	Identity:	40/136 - (29%)
Similarity:	63/136 - (46%)	Gaps:	28/136 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   470 MRTGAPKAKRSRSQKKSNQQQQQQQQQQQQQGDGGGQPTTPQMS------AISPSGFSASD---- 524
            |.|...|||...:....:.:.:|:.:::.         .:|:||      |:.|  |...|
Worm    52 MITDLKKAKFDFTHMADSIESEQKIKEES---------VSPKMSPTLTTAAVRP--FVPYDQPWF 105

  Fly   525 -------LSGLLGKEKPVHRCSICNRGFLNKSNIKVHLRTHTGEKPFRCDVCAKAFRQKAHLLKH 582
                   .:|...:.|....|..|:|.|....|:.:|.||||.|:|:.||||.||||::.||..|
Worm   106 MIPGRGRTTGRAARPKKEFICKYCDRHFTKSYNLLIHERTHTDERPYSCDVCGKAFRRQDHLRDH 170

  Fly   583 QQIHKR 588
            :.||::
Worm   171 KYIHQK 176

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ich	NP_001262393.1	C2H2 Zn finger	538..558	CDD:275368	7/19 (37%)
		zf-H2C2_2	550..575	CDD:316026	15/24 (63%)
		C2H2 Zn finger	566..586	CDD:275368	11/19 (58%)
odd-2	NP_509032.1	zf-C2H2	124..146	CDD:278523	7/21 (33%)
		C2H2 Zn finger	126..146	CDD:275368	7/19 (37%)
		zf-H2C2_2	138..163	CDD:290200	15/24 (63%)
		C2H2 Zn finger	154..174	CDD:275368	11/19 (58%)
		zf-H2C2_2	166..189	CDD:290200	5/11 (45%)
		zf-C2H2	180..202	CDD:278523
		C2H2 Zn finger	182..202	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	1	1.050	89	1.000	Inparanoid score	I3687
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.050