DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ich and odd-1

DIOPT Version :9

Sequence 1:NP_001262393.1 Gene:ich / 41069 FlyBaseID:FBgn0286204 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_498552.2 Gene:odd-1 / 181893 WormBaseID:WBGene00003845 Length:242 Species:Caenorhabditis elegans


Alignment Length:173 Identity:42/173 - (24%)
Similarity:68/173 - (39%) Gaps:32/173 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   416 LSNPTNNQATGNLHQQGGYSMQASGLSLKDNGLCSPDLLGNYPHTTTASTTGSEMRTGAPKAKRS 480
            |.:.:..|..|..|....:.          ..||........|...:.||..::|          
 Worm    40 LQSQSKEQVNGTSHDLQNWL----------TSLCISPSSSPTPSNASTSTIPAQM---------- 84

  Fly   481 RSQKKSNQQQQQQQQQQQQQGDGGGQPTTPQMSAISPSGFSASDLSGLLGKEKPVHRCSICNRGF 545
                 :|:.....|.|.|...:.|    ||..  ::|...:.:: :.:..:.|....|..|.|.|
 Worm    85 -----TNENVLHLQIQSQLFSNLG----TPWF--LNPEQHNKTN-NAIRKRPKKEFICKYCARHF 137

  Fly   546 LNKSNIKVHLRTHTGEKPFRCDVCAKAFRQKAHLLKHQQIHKR 588
            ....|:.:|.||||.|:||.|:.|.|:||::.||..|:.||.:
 Worm   138 TKSYNLMIHERTHTNERPFHCETCGKSFRRQDHLRDHKYIHAK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ichNP_001262393.1 C2H2 Zn finger 538..558 CDD:275368 7/19 (37%)
zf-H2C2_2 550..575 CDD:316026 13/24 (54%)
C2H2 Zn finger 566..586 CDD:275368 8/19 (42%)
odd-1NP_498552.2 C2H2 Zn finger 130..150 CDD:275368 7/19 (37%)
zf-H2C2_2 142..167 CDD:290200 13/24 (54%)
C2H2 Zn finger 158..178 CDD:275368 8/19 (42%)
zf-H2C2_2 170..193 CDD:290200 5/11 (45%)
C2H2 Zn finger 186..206 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I3687
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.