DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ScsbetaA and Acly

DIOPT Version :9

Sequence 1:NP_001163558.1 Gene:ScsbetaA / 41067 FlyBaseID:FBgn0037643 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_058683.2 Gene:Acly / 24159 RGDID:2018 Length:1101 Species:Rattus norvegicus


Alignment Length:484 Identity:110/484 - (22%)
Similarity:170/484 - (35%) Gaps:129/484 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LKTDNLVLKAQVLAGGRGKGTFKNGLKG------GVRVVYDPQTAEELSSKMIDQLLVTKQTGAA 133
            |.:.:||:|...|...||    |.||.|      ||:....|:...|.:            .|.|
  Rat    50 LLSQSLVVKPDQLIKRRG----KLGLVGVNLSLDGVKSWLKPRLGHEAT------------VGKA 98

  Fly   134 GRICKKVMVAERKFPR---REFYFAVMMERAFNGPVLIASKEGGVDIEEVAASSPDAILYEPIDI 195
            ....|..:: |...|.   .|||..:...|  .|..::...|||||:.:|...:...:    :.:
  Rat    99 KGFLKNFLI-EPFVPHSQAEEFYVCIYATR--EGDYVLFHHEGGVDVGDVDTKAQKLL----VGV 156

  Fly   196 GTGLTSEQAEKIVKKVGLGGDGED------THVQMLLNLY-DLFVKKDALLVEINP--YAEDAMS 251
            ...|.:|.    :|:..|....||      :.:..|.|.| ||:.    ..:||||  ..:|.: 
  Rat   157 DEKLNAED----IKRHLLVHAPEDKKEILASFISGLFNFYEDLYF----TYLEINPLVVTKDGV- 212

  Fly   252 GCFFALDAKLRFDDNAEFRQK---------ELFALRDWTQE----DPKEVEAAKYNLNYIALDGT 303
               :.||...:.|..|::..|         ..|....:.:|    |......|...|..:...|.
  Rat   213 ---YILDLAAKVDATADYICKVKWGDIEFPPPFGREAYPEEAYIADLDAKSGASLKLTLLNPKGR 274

  Fly   304 IGCMVNGAGLAMATMDIIKLYGG--EPANFLDVGGG----ATAEAVKAAFKIIT----SDPKVLC 358
            |..||.|.|.::...|.|...||  |.||:.:..|.    .|.:..|....::|    .|.|:| 
  Rat   275 IWTMVAGGGASVVYSDTICDLGGVNELANYGEYSGAPSEQQTYDYAKTILSLMTREKHPDGKIL- 338

  Fly   359 ILVNIFGGIMR--CDVIA--EGIISATKDL-----NLNMPVVVRLQGTKVKEA----RELIRTSG 410
                |.||.:.  .:|.|  :||:.|.:|.     ...:.:.||..|...:|.    .|:.:|:|
  Rat   339 ----IIGGSIANFTNVAATFKGIVRAIRDYQGPLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTG 399

  Fly   411 LKI----------------LARDDLDKAADLAVHLAQIVKLA---------------REMKMDVN 444
            :.|                |....:......|.|.|..:..|               .|.:.|  
  Rat   400 IPIHVFGTETHMTAIVGMALGHRPIPNQPPTAAHTANFLLNASGSTSTPAPSRTASFSESRAD-- 462

  Fly   445 FEIPDAQKGKGDCKKDQ-KQPDSKGGKKS 472
             |:..|:|.|....:|. ..|.|..||.:
  Rat   463 -EVAPAKKAKPAMPQDSVPSPRSLQGKSA 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScsbetaANP_001163558.1 PLN00124 28..427 CDD:177736 95/421 (23%)
ATP-grasp_4 39..247 CDD:302634 46/189 (24%)
Ligase_CoA 307..427 CDD:278948 36/158 (23%)
AclyNP_058683.2 Citrate_bind 1..419 CDD:421882 94/408 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..486 9/45 (20%)
PLN02522 489..1094 CDD:178137 0/2 (0%)
CoA-binding. /evidence=ECO:0000255 779..789
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.