DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pyd and SLC9A3R2

DIOPT Version :9

Sequence 1:NP_001246998.1 Gene:pyd / 41062 FlyBaseID:FBgn0262614 Length:2395 Species:Drosophila melanogaster
Sequence 2:XP_016879383.1 Gene:SLC9A3R2 / 9351 HGNCID:11076 Length:372 Species:Homo sapiens


Alignment Length:311 Identity:72/311 - (23%)
Similarity:112/311 - (36%) Gaps:57/311 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   523 DPYLPGGASY----SSQNLYVQPPTRTSNGPNIN----GNGLNDEKSNLTPRGRSRGPIMDGVSL 579
            :|....|.|:    .|.:....||.....||...    |..|...:|:..| ||:........::
Human    96 EPSQGSGLSHHPAPQSDSAPTSPPIPGEPGPQREVDKWGGSLGRPESSGHP-GRTPATCCHCAAV 159

  Fly   580 QQLDRPVTPTRGRSAAIDEPPRPPPPRGSSGGAAQEDFYSSRRQLYEERQSAEPRFISFQK--EG 642
            .......||.   :.|...|||.||.|....|..:|               ..||....:|  :|
Human   160 MARSGSATPP---ARAPGAPPRSPPQRLDVSGPLRE---------------LRPRLCHLRKGPQG 206

  Fly   643 SVGIRL-TGGNEAGIFVTAVQPGSPASLQGLMPGDKILKVNDMDMNGVTREEAVLFLLSLQDRID 706
             .|..| :..:..|.::.:|.|||||:..||...|::::||..::.|:...|.|..:.:.:|...
Human   207 -YGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 270

  Fly   707 LIVQYCKEEYDEVVTNQRGDSFHIK------THFHCDNPSKGEMAFKAGDVFRVIDTLHNGVVGS 765
            |:|  ...|.||          |.|      |..|.:.|....:.......     .|:.|...|
Human   271 LLV--VDPETDE----------HFKRLRVTPTEEHVEGPLPSPVTNGTSPA-----QLNGGSACS 318

  Fly   766 WQVLKIGRGHQEMQRG--VIPNKSRAEELATA-QFNATKKEMNANESRGNF 813
            .:....|......:.|  :.|..:.|:|.|.| :.|....:|:.|..|..|
Human   319 SRSDLPGSDKDTEESGLHLSPTAAEAKEKARAMRVNKRAPQMDWNRKREIF 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pydNP_001246998.1 PDZ_signaling 249..334 CDD:238492
PDZ_signaling 396..477 CDD:238492
PDZ_signaling 633..710 CDD:238492 23/79 (29%)
SH3_ZO 729..790 CDD:212793 11/68 (16%)
GuKc 831..1007 CDD:214504
ZU5 2263..2351 CDD:279170
SLC9A3R2XP_016879383.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.