DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pyd and PALS1

DIOPT Version :9

Sequence 1:NP_001246998.1 Gene:pyd / 41062 FlyBaseID:FBgn0262614 Length:2395 Species:Drosophila melanogaster
Sequence 2:NP_071919.2 Gene:PALS1 / 64398 HGNCID:18669 Length:675 Species:Homo sapiens


Alignment Length:433 Identity:91/433 - (21%)
Similarity:175/433 - (40%) Gaps:71/433 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   634 RFISFQKEGSVGIRLTGGNEA-GIFVTAVQPGSPASLQGLM-PGDKILKVNDMDMNGVTREEAVL 696
            :.:..:|...:.:..|..||. .:.::.:..|..|...||: .||::|::|.:::.|....|...
Human   255 KIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFD 319

  Fly   697 FLLSLQDRIDLIV----QYCKEEYDEVVTNQRGDSFHIKTHFHCDNPSKGE--------MAFKAG 749
            .|..:...:..::    |.......|.|       .|:|.||..| ||...        ::|:.|
Human   320 LLSDMHGTLTFVLIPSQQIKPPPAKE
TV-------IHVKAHFDYD-PSDDPYVPCRELGLSFQKG 376

  Fly   750 DVFRVIDTLHNGVVGSWQVLKIGRGHQEMQRGVIPNKSRAEELATAQFNATKKEMNANESRGNFF 814
            |:..||.   ......||..:.|....:...|::|.||..::  ......|.:|....|..|..:
Human   377 DILHVIS---QEDPNWWQAYREGDEDNQPLAGLVPGKSFQQQ--REAMKQTIEEDKEPEKSGKLW 436

  Fly   815 RRRRSTHRRSKSLSRENWDDVVFSDSISKFPAYERVVLRH--PGFVRPVVLFGPVS---DLARER 874
            ..:::..:|.|.|...|.:|...::.|.   .||.:.|.|  ....||::|.||.:   :..|:|
Human   437 CAKKNKKKRKKVLYNANKNDDYDNEEIL---TYEEMSLYHQPANRKRPIILIGPQNCGQNELRQR 498

  Fly   875 LAKDFPDKFSTPLQDDDKSA---------------------ATSGK----------CRIVRLSNI 908
            |.....|:|::.:....:|.                     ..:||          .....:.::
Human   499 LMNKEKDRFASAVPHTTRSRRDQEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSIDSV 563

  Fly   909 RDVMDRGKHALLDITPNAVDRLNYAQFYPVVIFLKTDSKHVIKQL--RHGL-PKAAHKSSKKLLE 970
            |.|::.||..||.:...::..|..:...|.:||:...|:..::.|  :.|. ||.  :..::::|
Human   564 RQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKP--EELREIIE 626

  Fly   971 QCQKLERVWSHIFSTQIALSDEESWYRKLRDSIDLQQSGAVWM 1013
            :.:::|:...|.|.|.|..||.:..|::|...|:...:...|:
Human   627 KTREMEQNNGHYFDTAIVNSDLDKAYQELLRLINKLDTEPQWV 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pydNP_001246998.1 PDZ_signaling 249..334 CDD:238492
PDZ_signaling 396..477 CDD:238492
PDZ_signaling 633..710 CDD:238492 15/81 (19%)
SH3_ZO 729..790 CDD:212793 19/68 (28%)
GuKc 831..1007 CDD:214504 46/214 (21%)
ZU5 2263..2351 CDD:279170
PALS1NP_071919.2 Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions. /evidence=ECO:0000250|UniProtKB:Q9JLB2 1..345 16/89 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
Interaction with PARD6B. /evidence=ECO:0000250|UniProtKB:Q9JLB2 21..140
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..78
L27_N 123..170 CDD:401122
Interaction with LIN7C. /evidence=ECO:0000250|UniProtKB:Q9JLB2 181..243
L27 189..237 CDD:197794
PDZ_signaling 254..333 CDD:238492 15/77 (19%)
SH3_MPP5 349..411 CDD:212969 17/65 (26%)
GuKc 491..661 CDD:214504 34/171 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.