DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pyd and slc9a3r1

DIOPT Version :9

Sequence 1:NP_001246998.1 Gene:pyd / 41062 FlyBaseID:FBgn0262614 Length:2395 Species:Drosophila melanogaster
Sequence 2:NP_001006751.1 Gene:slc9a3r1 / 448423 XenbaseID:XB-GENE-487362 Length:320 Species:Xenopus tropicalis


Alignment Length:175 Identity:46/175 - (26%)
Similarity:76/175 - (43%) Gaps:29/175 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   559 EKSNLTPRGRSRGPIMDGVSLQQLDRPVTPTRGRSA---------AIDEPPRPPPPRGSSGGAAQ 614
            ||:.|  |...|...:.|..:::|......::.|:|         .::|...|..|:        
 Frog    41 EKAGL--RAGDRLIRVCGEDVRELGHQQVVSKIRAATEKLTLEVQGVEEEVAPSSPK-------- 95

  Fly   615 EDFYSSRRQLYE--ERQSAEPRFISFQKEGS-VGIRLTGGN-EAGIFVTAVQPGSPASLQGLMPG 675
            |:..::.:|...  :|:...||..:.:|..| .|..|.... ..|.||.||.|.|||.|.||:|.
 Frog    96 EENKATEKQPTPVLDRKELRPRLCTIKKGPSGFGFNLHSDKVHPGQFVRAVDPDSPAELAGLLPK 160

  Fly   676 DKILKVNDMDMNGVTREEAVLFLLSLQDRIDLIV------QYCKE 714
            |:|::||.:::.|....:.|..:.:..|...|:|      .|.||
 Frog   161 DRIVEVNGLNVIGKQHGDVVAAIKAGGDETSLLVLDPEADSYFKE 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pydNP_001246998.1 PDZ_signaling 249..334 CDD:238492
PDZ_signaling 396..477 CDD:238492
PDZ_signaling 633..710 CDD:238492 28/84 (33%)
SH3_ZO 729..790 CDD:212793
GuKc 831..1007 CDD:214504
ZU5 2263..2351 CDD:279170
slc9a3r1NP_001006751.1 PDZ_signaling 4..83 CDD:238492 9/43 (21%)
PDZ_signaling 116..195 CDD:238492 27/78 (35%)
EBP50_C 199..320 CDD:370238 3/7 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.