DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pyd and sirt6

DIOPT Version :9

Sequence 1:NP_001246998.1 Gene:pyd / 41062 FlyBaseID:FBgn0262614 Length:2395 Species:Drosophila melanogaster
Sequence 2:NP_989353.1 Gene:sirt6 / 394980 XenbaseID:XB-GENE-5929105 Length:331 Species:Xenopus tropicalis


Alignment Length:347 Identity:64/347 - (18%)
Similarity:113/347 - (32%) Gaps:102/347 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   864 FGPVSDLAR------ERLAKDFPDKFSTPLQDDDKSAATSGKCRIVRL---SNIRDVMDRGKHAL 919
            |.|..:|.|      :.:.|.....|.|       .|..|..|.|...   :.:..:.::|.:..
 Frog    24 FDPPDELCRKVVELADMIRKSSYVVFHT-------GAGISTSCGIPDFRGPNGVWTLEEKGVNPK 81

  Fly   920 LDIT-----PN----AVDRLNYAQFYPVVIFLKTDSKHVIKQLRHGLPK--AAHKSSKKLLEQCQ 973
            .|||     |:    |:.:|........::....|..||    |.|.|:  .|.......:|:|.
 Frog    82 FDITFESACPSPTHMALLQLQRVGILKFLVSQNVDGLHV----RSGFPREQLAELHGNMFVEECS 142

  Fly   974 KLERVWSHIFSTQIALSDEESWYRKLRDSI-------------DLQQSGAVWMSESKPVESLSD- 1024
            |..:.:                   :||.:             |:.:...:.....|..:::.| 
 Frog   143 KCSKQY-------------------VRDQVVGTMGLKPTGRLCDVPKVRGLRACRGKLKDTILDW 188

  Fly  1025 -DFLFPMTTSRLSYASSPESDLELSPGPSASL-SLGNLPQLVKASSDPSIATNQDNLDRDR---- 1083
             |.| |.....|:..:..::||.::.|.|..: ..||||.|.|......:..|......|:    
 Frog   189 EDSL-PDRDLNLADEACRKADLSITLGTSLQIRPSGNLPLLTKRKGGKLVIVNLQPTKHDKHADL 252

  Fly  1084 --------------DIIGEGLPPPYTVPYDHAVPANPNRRQTMDSSKYSIYGTNVPPQQQQPGVG 1134
                          :::|..:|....:| ....|.|.|.::.......|:.|.|  |.|::.|..
 Frog   253 RIHGYVDEVMTQLMELLGHKIPVWTGMP-TKTEPTNGNYKEENHFYNDSVLGAN--PNQKREGCK 314

  Fly  1135 GDTAAVRPQSLYGINAPDLPPR 1156
            .:              |:|.|:
 Frog   315 EE--------------PNLEPK 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pydNP_001246998.1 PDZ_signaling 249..334 CDD:238492
PDZ_signaling 396..477 CDD:238492
PDZ_signaling 633..710 CDD:238492
SH3_ZO 729..790 CDD:212793
GuKc 831..1007 CDD:214504 31/175 (18%)
ZU5 2263..2351 CDD:279170
sirt6NP_989353.1 SIRT7 45..257 CDD:238701 44/242 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165172895
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.