DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pyd and sdcbp2

DIOPT Version :9

Sequence 1:NP_001246998.1 Gene:pyd / 41062 FlyBaseID:FBgn0262614 Length:2395 Species:Drosophila melanogaster
Sequence 2:NP_997856.1 Gene:sdcbp2 / 325004 ZFINID:ZDB-GENE-030131-3727 Length:299 Species:Danio rerio


Alignment Length:275 Identity:65/275 - (23%)
Similarity:110/275 - (40%) Gaps:62/275 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   508 QPQVSGCSSSNNNLEDPYLPGGASYSSQNLYVQPPTRTSNGPNINGNGLNDEKSNLTPRGRSRGP 572
            |.|.:..:||.     |.:..||        .||...|...|:          |.|.|.....|.
Zfish    19 QSQFANATSST-----PAITQGA--------YQPQPATQGMPS----------STLYPNLEELGD 60

  Fly   573 IMDGVSL--QQLDR-----PVTPTRGRSAAIDEPPRPPPPRGSSGGAAQEDFYSSRRQLYEERQS 630
            .| |:||  .::.|     ||.......:::....|  |..|:..|..:.:.....|::      
Zfish    61 YM-GLSLNSDEVQRNLALVPVATQVAVPSSVGGMVR--PVTGADMGIRRAEIRPGLREV------ 116

  Fly   631 AEPRFISFQKEGSVGIRLTGGNEAGIFVTAVQPGSPASLQGLMPGDKILKVNDMDMNGVTREEAV 695
                .:...:||.||:||. ..:.|:||..||..|||:|.||..||::|::|..::.|...::|.
Zfish   117 ----ILCKDQEGKVGLRLR-DIDNGVFVQLVQANSPAALAGLRFGDQVLQINGQNVAGWNSDKAH 176

  Fly   696 LFL-LSLQDRIDLIVQYCKEEYDEVVTNQRGDSFHIKTHFHCDNPSKGEMAFKAGDVFRVI---D 756
            ..| .:.:.||:|||:  ...:...:|..:..|.|:            ...||:|.:..::   .
Zfish   177 KALKAAAEQRIELIVR--DRPFQRTITMHKDSSGHV------------GFIFKSGRITSLVKDGS 227

  Fly   757 TLHNGVVGSWQVLKI 771
            ...||::....:.:|
Zfish   228 AARNGLLTEHYICEI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pydNP_001246998.1 PDZ_signaling 249..334 CDD:238492
PDZ_signaling 396..477 CDD:238492
PDZ_signaling 633..710 CDD:238492 28/77 (36%)
SH3_ZO 729..790 CDD:212793 7/46 (15%)
GuKc 831..1007 CDD:214504
ZU5 2263..2351 CDD:279170
sdcbp2NP_997856.1 PDZ_signaling 113..>173 CDD:238492 23/70 (33%)
PDZ_signaling 198..270 CDD:238492 9/57 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.