DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pyd and LOC100537443

DIOPT Version :9

Sequence 1:NP_001246998.1 Gene:pyd / 41062 FlyBaseID:FBgn0262614 Length:2395 Species:Drosophila melanogaster
Sequence 2:XP_003199722.2 Gene:LOC100537443 / 100537443 -ID:- Length:201 Species:Danio rerio


Alignment Length:200 Identity:49/200 - (24%)
Similarity:100/200 - (50%) Gaps:22/200 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   836 VFSDSISKFPAYERVVLRHPGFVRPVVLFGPVSDLARERLAKDFPDKFSTPLQDDDKS------- 893
            |..|.:|  |||:||:.......|||::.||:.:..::.|.::.|.|:...|.:..|:       
Zfish     1 VLPDCVS--PAYQRVLKVESTNRRPVLILGPLVEPIKDMLLREAPGKYCRCLPEGMKAQQQAIER 63

  Fly   894 ----------AATSGKCRIVRLSNIRDVMDRGKHALLDITPNAVDRLNYAQFYPVVIFLKTDSKH 948
                      ...||...:..:::|:::.::..|.||||.|:|::||:....||:|||::..:..
Zfish    64 GVKDCLFIDYKRRSGHFDVTTVASIKEITEKDCHCLLDIAPHAIERLHAVSIYPIVIFIRYRNAK 128

  Fly   949 VIKQLRHGL---PKAAHKSSKKLLEQCQKLERVWSHIFSTQIALSDEESWYRKLRDSIDLQQSGA 1010
            .||:.:..:   .|.:.|.||:..|..|::|:.:|..|:..:......:...::...:|.:|:..
Zfish   129 QIKEQKDPVYLRDKVSQKHSKEQFESAQRIEQDYSKYFTGVVQAGALSNTCTQIMAIVDQEQNKV 193

  Fly  1011 VWMSE 1015
            :|:.:
Zfish   194 LWIPD 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pydNP_001246998.1 PDZ_signaling 249..334 CDD:238492
PDZ_signaling 396..477 CDD:238492
PDZ_signaling 633..710 CDD:238492
SH3_ZO 729..790 CDD:212793
GuKc 831..1007 CDD:214504 47/190 (25%)
ZU5 2263..2351 CDD:279170
LOC100537443XP_003199722.2 NK 34..190 CDD:327404 34/155 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.