Sequence 1: | NP_001246998.1 | Gene: | pyd / 41062 | FlyBaseID: | FBgn0262614 | Length: | 2395 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_003199722.2 | Gene: | LOC100537443 / 100537443 | -ID: | - | Length: | 201 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 49/200 - (24%) |
---|---|---|---|
Similarity: | 100/200 - (50%) | Gaps: | 22/200 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 836 VFSDSISKFPAYERVVLRHPGFVRPVVLFGPVSDLARERLAKDFPDKFSTPLQDDDKS------- 893
Fly 894 ----------AATSGKCRIVRLSNIRDVMDRGKHALLDITPNAVDRLNYAQFYPVVIFLKTDSKH 948
Fly 949 VIKQLRHGL---PKAAHKSSKKLLEQCQKLERVWSHIFSTQIALSDEESWYRKLRDSIDLQQSGA 1010
Fly 1011 VWMSE 1015 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
pyd | NP_001246998.1 | PDZ_signaling | 249..334 | CDD:238492 | |
PDZ_signaling | 396..477 | CDD:238492 | |||
PDZ_signaling | 633..710 | CDD:238492 | |||
SH3_ZO | 729..790 | CDD:212793 | |||
GuKc | 831..1007 | CDD:214504 | 47/190 (25%) | ||
ZU5 | 2263..2351 | CDD:279170 | |||
LOC100537443 | XP_003199722.2 | NK | 34..190 | CDD:327404 | 34/155 (22%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |