DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pyd and LOC100496042

DIOPT Version :9

Sequence 1:NP_001246998.1 Gene:pyd / 41062 FlyBaseID:FBgn0262614 Length:2395 Species:Drosophila melanogaster
Sequence 2:XP_004919990.2 Gene:LOC100496042 / 100496042 -ID:- Length:853 Species:Xenopus tropicalis


Alignment Length:572 Identity:106/572 - (18%)
Similarity:181/572 - (31%) Gaps:158/572 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1223 QQQQTHASLERQARLNAQLKANGVGAGGGGASTYDSVSSYDSYNNTQMAMQNLGRLGPNAPD--- 1284
            :.|::|.::.:..:..|               .|..:.|:..:.:|.:......:...|:.:   
 Frog   248 KHQESHKTVHQCGQCKA---------------VYTRLGSFKKHMSTHLPQIATSQSTSNSENGEI 297

  Fly  1285 -DLKSVPNANGRPLPPTGQSHEYGRTPHDHRSFGGPNDLNRQSSPGRPHYHDMNASRNIDPRNGT 1348
             ....:..::..|....|::.|:.:|.....:|...|: |.|:.|                    
 Frog   298 QKFLQITTSHSMPSSENGKTQEFPQTTTSQSTFSSVNE-NTQTVP-------------------- 341

  Fly  1349 PQRPSNLGLESSPRKPLVETKTDYGKYSRNNSVTQADYTKLPKTAPHGVVPPPNVSN---GQGQM 1410
                              :|.|::||||.:.:......|    |..||.....|..|   .|..:
 Frog   342 ------------------QTTTNHGKYSEHGNTQTFPQT----TTSHGTFRSENRKNRKFPQTTV 384

  Fly  1411 NGSGTPSSNGS-----------GPFKPVPPPKPKNYRPPVQSGGSSGSGG-------TTPWENGD 1457
            |.....|.||:           |.|:.......|..:..|..||.|...|       ||....| 
 Frog   385 NHGSFSSENGNTQTFPQTTISHGTFRSENRKNRKCPKTAVSHGGFSSDNGNIQTFPQTTTIHGG- 448

  Fly  1458 SGSPRSPNGFYYPPTPSHHHYGQQATPGSPSNGHMQPPPPQQQQPTYGGSNGNYGQAPPPQSYPQ 1522
             .||.:.|...:|.|.:.|     .|..|.:....:.|........:...|||:      |::||
 Frog   449 -FSPENGNTQTFPQTTTSH-----GTFRSENRKKRKFPQTAVSHGGFSSDNGNF------QTFPQ 501

  Fly  1523 ANGYNGNGHHYNGGSGTGPYIA-PHRGMPPPIGNLP--PHTPERHALDLAGSREQRGSAFELYRK 1584
            |...:|.....||.:.|.|..| .|..:....||..  |.|...|     |:...:.:...|:::
 Frog   502 ATTIHGGFSPENGNTQTFPQTAVSHGTLSSESGNTQTFPQTTTSH-----GTFSSKNTKKFLHQE 561

  Fly  1585 ------------PQIGATAGHHHNMSEMEPYD----ERYDDYYNMPPPAA--HPSQGHHMQRSRS 1631
                        |.|   :.|.|.:.:.:|..    :|..|.::...|..  ......|.|.:.|
 Frog   562 ERDQNKMDRSGHPLI---SDHAHELKQNKPIKKETVKRKVDRFSSDRPFVDFQTKAKTHRQANVS 623

  Fly  1632 ---APRYPHERPPHAQDPNYYGHYGTSRGHSQPRQQYSQHHQQQYYDDHGLEMGPPPLPPHKKKK 1693
               ..|...:||...::               .:.|.:|:........|.:|:.|.|..|....|
 Frog   624 EDLLQRLQSQRPKTTKN---------------TKHQVTQNTTMNLIAPHKVELIPQPTAPTSNNK 673

  Fly  1694 SVLKSPLVALKNA------LLKSTRPLRRMNSMVEPERKPKGLRRQQSMLER 1739
            |:.......|:.|      ..|..:..|...|:         ||.::|..:|
 Frog   674 SLTSQSSTYLEKAEEDLFTCKKCKKRYRHRTSL---------LRHKKSHTQR 716

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pydNP_001246998.1 PDZ_signaling 249..334 CDD:238492
PDZ_signaling 396..477 CDD:238492
PDZ_signaling 633..710 CDD:238492
SH3_ZO 729..790 CDD:212793
GuKc 831..1007 CDD:214504
ZU5 2263..2351 CDD:279170
LOC100496042XP_004919990.2 KRAB 23..80 CDD:214630
C2H2 Zn finger 152..172 CDD:275368
C2H2 Zn finger 180..200 CDD:275368
C2H2 Zn finger 205..224 CDD:275368
C2H2 Zn finger 233..253 CDD:275368 1/4 (25%)
C2H2 Zn finger 693..713 CDD:275368 5/28 (18%)
C2H2 Zn finger 719..739 CDD:275368
C2H2 Zn finger 747..767 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.