| Sequence 1: | NP_001246998.1 | Gene: | pyd / 41062 | FlyBaseID: | FBgn0262614 | Length: | 2395 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_002941438.2 | Gene: | apba3 / 100495034 | XenbaseID: | XB-GENE-995533 | Length: | 630 | Species: | Xenopus tropicalis |
| Alignment Length: | 227 | Identity: | 48/227 - (21%) |
|---|---|---|---|
| Similarity: | 82/227 - (36%) | Gaps: | 88/227 - (38%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 253 VTRVPGYGFGIAV---------------SGGR-------DNPHFANGD----------------- 278
Fly 279 -----------PSIAVSDVLKGGPAE--DRLQVNDRIISVNGVSLENVEYATAVQVLRDSGNTVQ 330
Fly 331 LVVKRRVPLNPINAAGAVQHQHSHSLSSVGLMANGSGGVAPTPITSLSQPNSLNSSLVQNASSGQ 395
Fly 396 PIKVTLTKGGKKDDYGVVLGCRLFVKEISSKA 427 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| pyd | NP_001246998.1 | PDZ_signaling | 249..334 | CDD:238492 | 29/132 (22%) |
| PDZ_signaling | 396..477 | CDD:238492 | 8/32 (25%) | ||
| PDZ_signaling | 633..710 | CDD:238492 | |||
| SH3_ZO | 729..790 | CDD:212793 | |||
| GuKc | 831..1007 | CDD:214504 | |||
| ZU5 | 2263..2351 | CDD:279170 | |||
| apba3 | XP_002941438.2 | PTB_X11 | 269..414 | CDD:269919 | 4/15 (27%) |
| PDZ_signaling | 448..525 | CDD:238492 | 17/99 (17%) | ||
| PDZ_signaling | 538..611 | CDD:238492 | 14/55 (25%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||