DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pyd and cytip

DIOPT Version :9

Sequence 1:NP_001246998.1 Gene:pyd / 41062 FlyBaseID:FBgn0262614 Length:2395 Species:Drosophila melanogaster
Sequence 2:XP_031749616.1 Gene:cytip / 100487714 XenbaseID:XB-GENE-1000173 Length:361 Species:Xenopus tropicalis


Alignment Length:381 Identity:81/381 - (21%)
Similarity:118/381 - (30%) Gaps:121/381 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   549 PNINGNGLNDEKSNL-------TPRGRSRGPIMDGVSLQQLDRPVTPTRGRSAAIDEPPRPPPPR 606
            |.:..|.:|.::|:.       .|||.....:.                 ||.::.|        
 Frog    27 PQMCSNEINGKRSHFLARALATLPRGHKHAAMT-----------------RSNSLIE-------- 66

  Fly   607 GSSGGAAQEDFYSSRRQLYEERQSAEPRFISFQKEGSVGIRLTGGN----EAGIFVTAVQPGSPA 667
             |||...|      ||.|...:|..|......|.     .:|...|    |...:|..|...||:
 Frog    67 -SSGTGPQ------RRLLAVVKQDNETFGFEIQT-----YKLQHQNVHAYEMCTYVCRVHDNSPS 119

  Fly   668 SLQGLMPGDKILKVNDMDMNGVTREEAVLFLLSLQDRIDLIVQYCKEEYDEVV--TNQRGDSFHI 730
            |..||..||.:..||.:..:|.|.:|.|       |.|.....|.:   .|.|  |..|......
 Frog   120 SRAGLKIGDMLKTVNGVCTDGFTHQETV-------DLIRASGNYLR---IEAVNGTKIRKSELEA 174

  Fly   731 KTHFHCDNPSKGEMAFKAGDVFRVIDTLHNGVVGSWQVLKIGRGHQEMQRGVIP---------NK 786
            |..|     .|.:...|..::..|:......:.|:....||......:|..:..         ||
 Frog   175 KLLF-----LKQDFREKWAELRTVLRKEQEIIYGTVDEQKIQEAMDSLQSKMFESPTASTSFLNK 234

  Fly   787 SRA----------------------------EELATAQFNATKK--------EMNANESRGNFFR 815
            .|.                            |:.|:..|:....        :.|...|:.:...
 Frog   235 HRVSSGSSCKSRLSFMTDSSDDYLWQMSVFDEDSASEGFSRQSSIDEDTFYGKPNGISSKRSSLS 299

  Fly   816 RRRS---THRRSKSLSRENWDDVVFSDSISKFPAYER--VVLRH-----PGFVRPV 861
            |.||   |...|:|:| .|||.:.||:.....|...|  .:.:|     ||..|.|
 Frog   300 RHRSISVTSSGSESMS-PNWDTLSFSNFFGTLPRKSRRGSIRKHFLKYIPGLHRSV 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pydNP_001246998.1 PDZ_signaling 249..334 CDD:238492
PDZ_signaling 396..477 CDD:238492
PDZ_signaling 633..710 CDD:238492 21/80 (26%)
SH3_ZO 729..790 CDD:212793 12/97 (12%)
GuKc 831..1007 CDD:214504 12/38 (32%)
ZU5 2263..2351 CDD:279170
cytipXP_031749616.1 PDZ_signaling 75..160 CDD:238492 26/99 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.