DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IscU and ISU1

DIOPT Version :9

Sequence 1:NP_649840.1 Gene:IscU / 41059 FlyBaseID:FBgn0037637 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_015190.1 Gene:ISU1 / 855968 SGDID:S000006056 Length:165 Species:Saccharomyces cerevisiae


Alignment Length:133 Identity:96/133 - (72%)
Similarity:108/133 - (81%) Gaps:1/133 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RVQSVPVALYHENVVEHYENPRNVGSLDKKDVTVGTGLVGAPACGDVMKLQIKV-DENGKIVDAK 80
            |..|:...|||..|:|||.:||||||||||...|||||||||||||||:||||| |..|.|.|.|
Yeast    26 RASSITKRLYHPKVIEHYTHPRNVGSLDKKLPNVGTGLVGAPACGDVMRLQIKVNDSTGVIEDVK 90

  Fly    81 FKTFGCGSAIASSSLATEWVKGKSIDEAGKLKNTDIAKELRLPPVKLHCSMLAEDAIKAALADYK 145
            ||||||||||||||..||.|:|.::|:|.|:|||:|||||.|||||||||||||||||||:.|||
Yeast    91 FKTFGCGSAIASSSYMTELVQGMTLDDAAKIKNTEIAKELSLPPVKLHCSMLAEDAIKAAIKDYK 155

  Fly   146 VKQ 148
            .|:
Yeast   156 SKR 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IscUNP_649840.1 PRK11325 26..150 CDD:183087 93/124 (75%)
ISU1NP_015190.1 PRK11325 35..159 CDD:183087 93/124 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346806
Domainoid 1 1.000 186 1.000 Domainoid score I663
eggNOG 1 0.900 - - E1_COG0822
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6991
Inparanoid 1 1.050 190 1.000 Inparanoid score I914
Isobase 1 0.950 - 0 Normalized mean entropy S113
OMA 1 1.010 - - QHG60657
OrthoFinder 1 1.000 - - FOG0002367
OrthoInspector 1 1.000 - - otm46624
orthoMCL 1 0.900 - - OOG6_100973
Panther 1 1.100 - - LDO PTHR10093
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2165
SonicParanoid 1 1.000 - - X1562
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.