DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IscU and ISU1

DIOPT Version :10

Sequence 1:NP_649840.1 Gene:IscU / 41059 FlyBaseID:FBgn0037637 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_193953.1 Gene:ISU1 / 828316 AraportID:AT4G22220 Length:167 Species:Arabidopsis thaliana


Alignment Length:153 Identity:103/153 - (67%)
Similarity:121/153 - (79%) Gaps:12/153 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLRSQLKRV------QSVP-----VALYHENVVEHYENPRNVGSLDKKDVTVGTGLVGAPACGDV 63
            :|:...|:.      ||.|     :..|||||::||:|||||||.||.|..||||||||||||||
plant     2 MLKQAAKKALGLTSRQSTPWSVGILRTYHENVIDHYDNPRNVGSFDKNDPNVGTGLVGAPACGDV 66

  Fly    64 MKLQIKVDE-NGKIVDAKFKTFGCGSAIASSSLATEWVKGKSIDEAGKLKNTDIAKELRLPPVKL 127
            ||||||||| .|:||||:||||||||||||||:||||||||::::...:|||:|||.|.||||||
plant    67 MKLQIKVDEKTGQIVDARFKTFGCGSAIASSSVATEWVKGKAMEDVLTIKNTEIAKHLSLPPVKL 131

  Fly   128 HCSMLAEDAIKAALADYKVKQQK 150
            |||||||||||||:.|||.|:.|
plant   132 HCSMLAEDAIKAAVKDYKEKRVK 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IscUNP_649840.1 iscU 26..148 CDD:188192 96/122 (79%)
ISU1NP_193953.1 iscU 29..152 CDD:188192 96/122 (79%)

Return to query results.
Submit another query.