DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IscU and Iscu

DIOPT Version :9

Sequence 1:NP_649840.1 Gene:IscU / 41059 FlyBaseID:FBgn0037637 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_030110614.1 Gene:Iscu / 66383 MGIID:1913633 Length:290 Species:Mus musculus


Alignment Length:126 Identity:97/126 - (76%)
Similarity:106/126 - (84%) Gaps:2/126 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SSRLLRSQL--KRVQSVPVALYHENVVEHYENPRNVGSLDKKDVTVGTGLVGAPACGDVMKLQIK 69
            |:.||||..  .|..|.|..|||:.||:|||||||||||||....|||||||||||||||||||:
Mouse    96 SALLLRSPRLPARELSAPARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQ 160

  Fly    70 VDENGKIVDAKFKTFGCGSAIASSSLATEWVKGKSIDEAGKLKNTDIAKELRLPPVKLHCS 130
            |||.||||||:|||||||||||||||||||||||:::||..:|||||||||.|||||||||
Mouse   161 VDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCS 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IscUNP_649840.1 PRK11325 26..150 CDD:183087 88/105 (84%)
IscuXP_030110614.1 PRK11325 117..221 CDD:183087 86/103 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 217 1.000 Domainoid score I2673
eggNOG 1 0.900 - - E1_COG0822
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6991
Inparanoid 1 1.050 225 1.000 Inparanoid score I3492
Isobase 1 0.950 - 0 Normalized mean entropy S113
OMA 1 1.010 - - QHG60657
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002367
OrthoInspector 1 1.000 - - oto92545
orthoMCL 1 0.900 - - OOG6_100973
Panther 1 1.100 - - LDO PTHR10093
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2165
SonicParanoid 1 1.000 - - X1562
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.810

Return to query results.
Submit another query.