DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IscU and si:ch211-191d15.2

DIOPT Version :9

Sequence 1:NP_649840.1 Gene:IscU / 41059 FlyBaseID:FBgn0037637 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001003632.1 Gene:si:ch211-191d15.2 / 445238 ZFINID:ZDB-GENE-040724-113 Length:165 Species:Danio rerio


Alignment Length:143 Identity:111/143 - (77%)
Similarity:123/143 - (86%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SSRLLRSQLKRVQSVPVALYHENVVEHYENPRNVGSLDKKDVTVGTGLVGAPACGDVMKLQIKVD 71
            ||.|....:...:..|...||:.||:|||||||||||||....|||||||||||||||||||:||
Zfish    12 SSALFSKSMSLPELRPACSYHKKVVDHYENPRNVGSLDKNAKNVGTGLVGAPACGDVMKLQIQVD 76

  Fly    72 ENGKIVDAKFKTFGCGSAIASSSLATEWVKGKSIDEAGKLKNTDIAKELRLPPVKLHCSMLAEDA 136
            |||||:||:||||||||||||||||||||||||||||.|:|||:|||||.|||||||||||||||
Zfish    77 ENGKIIDARFKTFGCGSAIASSSLATEWVKGKSIDEALKIKNTEIAKELCLPPVKLHCSMLAEDA 141

  Fly   137 IKAALADYKVKQQ 149
            ||||||||::||:
Zfish   142 IKAALADYRLKQK 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IscUNP_649840.1 PRK11325 26..150 CDD:183087 107/124 (86%)
si:ch211-191d15.2NP_001003632.1 PRK11325 30..154 CDD:183087 106/123 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596851
Domainoid 1 1.000 220 1.000 Domainoid score I2559
eggNOG 1 0.900 - - E1_COG0822
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6991
Inparanoid 1 1.050 225 1.000 Inparanoid score I3481
OMA 1 1.010 - - QHG60657
OrthoDB 1 1.010 - - D1406557at2759
OrthoFinder 1 1.000 - - FOG0002367
OrthoInspector 1 1.000 - - otm24290
orthoMCL 1 0.900 - - OOG6_100973
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2165
SonicParanoid 1 1.000 - - X1562
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.700

Return to query results.
Submit another query.