DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IscU and iscu

DIOPT Version :9

Sequence 1:NP_649840.1 Gene:IscU / 41059 FlyBaseID:FBgn0037637 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_989088.1 Gene:iscu / 394688 XenbaseID:XB-GENE-946406 Length:158 Species:Xenopus tropicalis


Alignment Length:133 Identity:108/133 - (81%)
Similarity:119/133 - (89%) Gaps:0/133 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VPVALYHENVVEHYENPRNVGSLDKKDVTVGTGLVGAPACGDVMKLQIKVDENGKIVDAKFKTFG 85
            ||.|.||:.||:|||||||||||||....|||||||||||||||||||:||.||||::|||||||
 Frog    22 VPCASYHKKVVDHYENPRNVGSLDKNAKNVGTGLVGAPACGDVMKLQIEVDNNGKIIEAKFKTFG 86

  Fly    86 CGSAIASSSLATEWVKGKSIDEAGKLKNTDIAKELRLPPVKLHCSMLAEDAIKAALADYKVKQQK 150
            ||||||||||||||||||::|||..:|||||||||.||||||||||||||||:||||||::||.|
 Frog    87 CGSAIASSSLATEWVKGKTVDEAMTIKNTDIAKELCLPPVKLHCSMLAEDAIRAALADYRLKQDK 151

  Fly   151 KVA 153
            ..|
 Frog   152 DEA 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IscUNP_649840.1 PRK11325 26..150 CDD:183087 103/123 (84%)
iscuNP_989088.1 PRK11325 26..151 CDD:183087 103/124 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 214 1.000 Domainoid score I2682
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6991
Inparanoid 1 1.050 221 1.000 Inparanoid score I3451
OMA 1 1.010 - - QHG60657
OrthoDB 1 1.010 - - D1406557at2759
OrthoFinder 1 1.000 - - FOG0002367
OrthoInspector 1 1.000 - - oto102846
Panther 1 1.100 - - LDO PTHR10093
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2165
SonicParanoid 1 1.000 - - X1562
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.