DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IscU and ISCU

DIOPT Version :9

Sequence 1:NP_649840.1 Gene:IscU / 41059 FlyBaseID:FBgn0037637 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_998760.1 Gene:ISCU / 23479 HGNCID:29882 Length:167 Species:Homo sapiens


Alignment Length:147 Identity:115/147 - (78%)
Similarity:126/147 - (85%) Gaps:2/147 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SSRLLRSQL--KRVQSVPVALYHENVVEHYENPRNVGSLDKKDVTVGTGLVGAPACGDVMKLQIK 69
            |:.||||..  .|..|.|..|||:.||:|||||||||||||....|||||||||||||||||||:
Human    14 SALLLRSPRLPARELSAPARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQ 78

  Fly    70 VDENGKIVDAKFKTFGCGSAIASSSLATEWVKGKSIDEAGKLKNTDIAKELRLPPVKLHCSMLAE 134
            |||.||||||:|||||||||||||||||||||||:::||..:|||||||||.|||||||||||||
Human    79 VDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAE 143

  Fly   135 DAIKAALADYKVKQQKK 151
            |||||||||||:||:.|
Human   144 DAIKAALADYKLKQEPK 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IscUNP_649840.1 PRK11325 26..150 CDD:183087 105/123 (85%)
ISCUNP_998760.1 PRK11325 35..158 CDD:183087 104/122 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160472
Domainoid 1 1.000 216 1.000 Domainoid score I2700
eggNOG 1 0.900 - - E1_COG0822
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6991
Inparanoid 1 1.050 225 1.000 Inparanoid score I3516
Isobase 1 0.950 - 0 Normalized mean entropy S113
OMA 1 1.010 - - QHG60657
OrthoDB 1 1.010 - - D1406557at2759
OrthoFinder 1 1.000 - - FOG0002367
OrthoInspector 1 1.000 - - oto88979
orthoMCL 1 0.900 - - OOG6_100973
Panther 1 1.100 - - LDO PTHR10093
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2165
SonicParanoid 1 1.000 - - X1562
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.