DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IscU and iscu-1

DIOPT Version :9

Sequence 1:NP_649840.1 Gene:IscU / 41059 FlyBaseID:FBgn0037637 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_502658.1 Gene:iscu-1 / 178344 WormBaseID:WBGene00012885 Length:153 Species:Caenorhabditis elegans


Alignment Length:152 Identity:106/152 - (69%)
Similarity:128/152 - (84%) Gaps:1/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSL-VRNSSRLLRSQLKRVQSVPVALYHENVVEHYENPRNVGSLDKKDVTVGTGLVGAPACGDVM 64
            ||| :.::::.|..:.....:..||.|||.|::|||||||||||||.|.:||||:||||||||||
 Worm     1 MSLQISSAAKTLLHKFALPAATSVAQYHEKVIDHYENPRNVGSLDKNDPSVGTGIVGAPACGDVM 65

  Fly    65 KLQIKVDENGKIVDAKFKTFGCGSAIASSSLATEWVKGKSIDEAGKLKNTDIAKELRLPPVKLHC 129
            ||||:||:||||::|||||||||||||||||||||:.||:||.|.|:||.:|||||.||||||||
 Worm    66 KLQIRVDDNGKIIEAKFKTFGCGSAIASSSLATEWINGKTIDYASKIKNDEIAKELCLPPVKLHC 130

  Fly   130 SMLAEDAIKAALADYKVKQQKK 151
            ||||:|||:|||.||:.||.||
 Worm   131 SMLAQDAIQAALKDYQKKQTKK 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IscUNP_649840.1 PRK11325 26..150 CDD:183087 98/123 (80%)
iscu-1NP_502658.1 PRK11325 27..151 CDD:183087 98/123 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167908
Domainoid 1 1.000 211 1.000 Domainoid score I1636
eggNOG 1 0.900 - - E1_COG0822
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6991
Inparanoid 1 1.050 217 1.000 Inparanoid score I2318
Isobase 1 0.950 - 0 Normalized mean entropy S113
OMA 1 1.010 - - QHG60657
OrthoDB 1 1.010 - - D1406557at2759
OrthoFinder 1 1.000 - - FOG0002367
OrthoInspector 1 1.000 - - oto19510
orthoMCL 1 0.900 - - OOG6_100973
Panther 1 1.100 - - LDO PTHR10093
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2165
SonicParanoid 1 1.000 - - X1562
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1817.750

Return to query results.
Submit another query.