DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aqz and pnrc2

DIOPT Version :9

Sequence 1:NP_001262390.1 Gene:aqz / 41058 FlyBaseID:FBgn0286516 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001008433.1 Gene:pnrc2 / 493263 XenbaseID:XB-GENE-490316 Length:136 Species:Xenopus tropicalis


Alignment Length:168 Identity:44/168 - (26%)
Similarity:60/168 - (35%) Gaps:50/168 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 VGGGGFFFANNNRRNGGG----------RSPQGAMQVRQSPATILGGGFS-------PGIVGGSA 183
            :|||..|......||..|          |:.| .|....|...:.|.|.|       .|:...:.
 Frog     1 MGGGERFNIPGQHRNNLGKQINRQKLLERNNQ-KMNTSLSKDRVRGCGTSLAWQAMQNGVNNNNT 64

  Fly   184 RKQRKSPSLGGKISPQHQMQQHPLIPTALTHFAGSKCFDAPAPTALPKPPQHWT-LSRSEGKLPM 247
            |...::.|.|...|......|..      .::||:|..:.|:|:.|||||.||. ||.|..:..:
 Frog    65 RSSNQNWSAGFPASKNFFTDQDN------QNYAGAKFSEPPSPSVLPKPPSHWVLLSCSPAEKEL 123

  Fly   248 MMPSMPKFQVPMQTGRSKRNLLDDFDTHNLKLLLNVQS 285
            |     .||                    ||.||.||:
 Frog   124 M-----SFQ--------------------LKTLLKVQA 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aqzNP_001262390.1 PNRC 213..283 CDD:292009 22/70 (31%)
pnrc2NP_001008433.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 7/20 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..78 4/19 (21%)
PNRC 90..108 CDD:373788 8/17 (47%)
SH3-binding 96..102 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15405
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.