DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aqz and CG32797

DIOPT Version :9

Sequence 1:NP_001262390.1 Gene:aqz / 41058 FlyBaseID:FBgn0286516 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_726810.1 Gene:CG32797 / 318215 FlyBaseID:FBgn0052797 Length:202 Species:Drosophila melanogaster


Alignment Length:179 Identity:117/179 - (65%)
Similarity:127/179 - (70%) Gaps:29/179 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 NQRQRQLQS--QSTGSKNKYQQSQQQRQSPQQQQGSSVGGGGFFFANNNRRNGGGRSPQGAMQVR 163
            |||||||||  |||.||.|:|:||      |||||||.|||     ||.|||..||..|||.|:|
  Fly    15 NQRQRQLQSQYQSTASKFKHQKSQ------QQQQGSSKGGG-----NNKRRNRAGRWHQGARQLR 68

  Fly   164 QSPATILGGGFSPGIVGGSARKQRKSPSLGGKISPQHQM-QQHPLIPTALTHFAGSKCFDAPAPT 227
            |||.||..|||.||||.||:||||||..||||||.|||: ||||.||::|||||.||||.||.||
  Fly    69 QSPVTIWNGGFCPGIVRGSSRKQRKSSWLGGKISAQHQIQQQHPRIPSSLTHFAVSKCFLAPPPT 133

  Fly   228 ALPKPPQHWTLSRSEGKLPMMMPSMPKFQVPMQTGRSKRNLLDDFDTHN 276
            |||.||:|||||||:|               ||||.|||||||||:|||
  Fly   134 ALPNPPEHWTLSRSKG---------------MQTGLSKRNLLDDFETHN 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aqzNP_001262390.1 PNRC 213..283 CDD:292009 41/64 (64%)
CG32797NP_726810.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I7511
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016629
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15405
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.