DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aqz and Pnrc1

DIOPT Version :9

Sequence 1:NP_001262390.1 Gene:aqz / 41058 FlyBaseID:FBgn0286516 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_775444.2 Gene:Pnrc1 / 286988 RGDID:628753 Length:297 Species:Rattus norvegicus


Alignment Length:328 Identity:66/328 - (20%)
Similarity:98/328 - (29%) Gaps:177/328 - (53%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PSP-TSAPVSPTSVSASAPATPLVTAHSNSIASSTNNAQFLSSSPTSLGFGLGLSALATPPNQRQ 104
            |:| |:||.|.:.|.|:||.                                     |.|..:|:
  Rat    64 PAPRTAAPSSCSLVPAAAPR-------------------------------------AAPKKRRK 91

  Fly   105 RQLQSQSTGS-KNKYQQSQQQRQSPQQQQGSSVGGGGFFFANNNRRNGGGRSPQG---AMQVRQS 165
            :::::...|. .:::.|.||.|.|.:                      |||||..   |.|..:.
  Rat    92 KKVRASPAGQLPSRFHQFQQHRPSLE----------------------GGRSPVPGPIAAQEERG 134

  Fly   166 PATILGGGFSPGIVGGSARKQRKSP--------SLG--GKISPQHQMQQHPL------------- 207
            |             |.:|...|:.|        .:|  .||||.|....|.:             
  Rat   135 P-------------GATALLYRQPPLAKEVLKSKMGKSEKISPPHSQLVHGIHLCEQPKISRQKS 186

  Fly   208 ---IP-TALT---------------------------------------------------HFAG 217
               :| |.:|                                                   ::||
  Rat   187 KFNLPLTKITSAKRNENDFWQDSASSDRMQKQEKKPLKNTENIKNNHLKKSAFLTEGSQKENYAG 251

  Fly   218 SKCFDAPAPTALPKPPQHWTLSRSEGKLPMMMPSMPKFQVPMQTGRSKRNLLDDFDTHNLKLLLN 282
            :|..|.|:|:.|||||.||..|.:|.              |.|:    |.|:    ..:||.||.
  Rat   252 AKFSDPPSPSVLPKPPSHWMGSTTEN--------------PSQS----RELM----AVHLKTLLK 294

  Fly   283 VQS 285
            ||:
  Rat   295 VQT 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aqzNP_001262390.1 PNRC 213..283 CDD:292009 24/120 (20%)
Pnrc1NP_775444.2 PNRC 249..267 CDD:405947 9/17 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15405
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.