DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aqz and PNRC1

DIOPT Version :9

Sequence 1:NP_001262390.1 Gene:aqz / 41058 FlyBaseID:FBgn0286516 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_006804.1 Gene:PNRC1 / 10957 HGNCID:17278 Length:327 Species:Homo sapiens


Alignment Length:337 Identity:65/337 - (19%)
Similarity:96/337 - (28%) Gaps:169/337 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 TPSPTSAPVSPTSVSASAPATPLVTAHSNSIASSTNNAQFLSSSPTSLGFGLGLSALATPPNQRQ 104
            ||.|.:....|....|.|..||                                  .|.|..:|:
Human    69 TPQPRAPAALPNRSLAVAGGTP----------------------------------RAAPKKRRK 99

  Fly   105 RQLQSQSTGS-KNKYQQSQQQRQSPQQQQGSSVGGGGFFFANNNRRNGGGRS----PQGAMQV-- 162
            :::::...|. .:::.|.||.|.|.:                      ||||    |.||.:|  
Human   100 KKVRASPAGQLPSRFHQYQQHRPSLE----------------------GGRSPATGPSGAQEVPG 142

  Fly   163 -----RQSPATILG-GGFSPGIV-------GGS-ARKQRKSPSLG--GKISPQH----------- 200
                 ..|||...| .|.||.:.       |.: .||:.....:|  .||:..|           
Human   143 PAAALAPSPAAAAGTEGASPDLAPLRPAAPGQTPLRKEVLKSKMGKSEKIALPHGQLVHGIHLYE 207

  Fly   201 ------QMQQHPLIPTALT---------------------------------------------- 213
                  |..::.|..|.:|                                              
Human   208 QPKINRQKSKYNLPLTKITSAKRNENNFWQDSVSSDRIQKQEKKPFKNTENIKNSHLKKSAFLTE 272

  Fly   214 -----HFAGSKCFDAPAPTALPKPPQHWTLSRSEGKLPMMMPSMPKFQVPMQTGRSKRNLLDDFD 273
                 ::||:|..|.|:|:.|||||.||..|                  .::.....|.|:    
Human   273 VSQKENYAGAKFSDPPSPSVLPKPPSHWMGS------------------TVENSNQNRELM---- 315

  Fly   274 THNLKLLLNVQS 285
            ..:||.||.||:
Human   316 AVHLKTLLKVQT 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aqzNP_001262390.1 PNRC 213..283 CDD:292009 21/120 (18%)
PNRC1NP_006804.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..175 33/161 (20%)
Nuclear localization signal. /evidence=ECO:0000269|PubMed:10894149 94..101 2/6 (33%)
PNRC 277..325 CDD:292009 20/69 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..300 11/19 (58%)
SH3-binding 285..291 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144710
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15405
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.