DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aqz and Pnrc1

DIOPT Version :9

Sequence 1:NP_001262390.1 Gene:aqz / 41058 FlyBaseID:FBgn0286516 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001028397.2 Gene:Pnrc1 / 108767 MGIID:1917838 Length:297 Species:Mus musculus


Alignment Length:317 Identity:64/317 - (20%)
Similarity:92/317 - (29%) Gaps:155/317 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PSP-TSAPVSPTSVSASAPATPLVTAHSNSIASSTNNAQFLSSSPTSLGFGLGLSALATPPNQRQ 104
            |:| |:||...|...|:||.                                     |.|..:|:
Mouse    64 PAPRTTAPSGCTLAPAAAPR-------------------------------------AAPKKRRK 91

  Fly   105 RQLQSQSTGS-KNKYQQSQQQRQSPQQQQGSSVGGGGFFFANNNRRNGGGRSPQG----AMQVRQ 164
            :::::...|. .:::.|.||.|.|.:                      |||||..    |.:.|.
Mouse    92 KKVRASPAGQLPSRFHQFQQHRPSLE----------------------GGRSPAPGPIVAQEERG 134

  Fly   165 SPATILGGGFSPGIVGGSARKQRKSPSLG---------------GKISPQHQMQQHPLIPTALT- 213
            ..||.|.....|........|..||..:.               .||:.|......||  |.:| 
Mouse   135 LAATALLHRQPPLAKEVLKSKMGKSEKIALPHSQLVHGIHLCEQPKINRQKSKYNLPL--TKITS 197

  Fly   214 --------------------------------------------------HFAGSKCFDAPAPTA 228
                                                              ::||:|..|.|:|:.
Mouse   198 AKRNESDFWQDSASSDRMQKQEKKSFKNTENIKSNHLKKSAFLTEVSQKENYAGAKFSDPPSPSV 262

  Fly   229 LPKPPQHWTLSRSEGKLPMMMPSMPKFQVPMQTGRSKRNLLDDFDTHNLKLLLNVQS 285
            |||||.||..|.:|.              |.|:    |.|:    ..:||.||.||:
Mouse   263 LPKPPSHWMGSTAEN--------------PSQS----RELM----AVHLKTLLKVQT 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aqzNP_001262390.1 PNRC 213..283 CDD:292009 24/120 (20%)
Pnrc1NP_001028397.2 PNRC 247..295 CDD:292009 23/69 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834822
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15405
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.