DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aqz and pnrc1

DIOPT Version :9

Sequence 1:NP_001262390.1 Gene:aqz / 41058 FlyBaseID:FBgn0286516 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001076548.1 Gene:pnrc1 / 100034521 ZFINID:ZDB-GENE-040724-189 Length:197 Species:Danio rerio


Alignment Length:215 Identity:47/215 - (21%)
Similarity:74/215 - (34%) Gaps:82/215 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 QRQRQLQSQST--------GSKNKYQQSQQQRQSPQQQQ--------GSSVGGGGFFFA------ 144
            :|.|.:.|::.        ||.|:..:..|.:.:|.:||        ||.:........      
Zfish    31 KRGRNVHSKANNTSANIHRGSANEELKPAQSKPAPNKQQPKSCTAERGSQISRASILNCSRLEQT 95

  Fly   145 --NNNRRNGGGRSPQGAMQ-----VRQSPATILGGGFSPGIVGGSARKQRKSPSLGGKISPQHQM 202
              |.|||....:....|.|     ..:||..||              ||       |..|.....
Zfish    96 TDNLNRRTHQSKHQINARQDKPTSTEKSPENIL--------------KQ-------GNASTSSDA 139

  Fly   203 QQHPLIPTALTHFAGSKCFDAPAPTALPKPPQHWTLSRSEGKLPMMMPSMPKFQVPMQTGR--SK 265
            ::         .:||:|..:.|:|:.|||||:||....:                |..|.:  |:
Zfish   140 EK---------TYAGAKFSEPPSPSVLPKPPRHWVGDHA----------------PQHTHKHCSR 179

  Fly   266 RNLLDDFDTHNLKLLLNVQS 285
            ..:     :.:||.||.||:
Zfish   180 EQM-----SEHLKTLLKVQT 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aqzNP_001262390.1 PNRC 213..283 CDD:292009 19/71 (27%)
pnrc1NP_001076548.1 PNRC 141..192 CDD:292009 19/80 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577898
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15405
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.