DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng2 and si:ch211-207i20.3

DIOPT Version :9

Sequence 1:NP_649837.1 Gene:hng2 / 41056 FlyBaseID:FBgn0037634 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_683419.5 Gene:si:ch211-207i20.3 / 555734 ZFINID:ZDB-GENE-141222-71 Length:263 Species:Danio rerio


Alignment Length:250 Identity:58/250 - (23%)
Similarity:100/250 - (40%) Gaps:78/250 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NLRYSMYEFIDA------VHKRSIIWERSHPNFHNRELRDEAWQQIGHELCSNFDDSSEPEKQEI 71
            ::|.||...:||      |.:...:::::|..:.|.:.::..||.|..::..:.::         
Zfish    21 SVRRSMVVKMDAELLLFLVSENKELFDKNHSEYKNTKRKEALWQGIADKMGVDVEE--------- 76

  Fly    72 VKTLLKRWKNTRDSYLRVNRLRQSGEEVARAS-----YIYEKELSFL----------LNVKAESE 121
            ||.   :|||.||:|.|..||.|.|....||:     :.|.:.:.||          |:.|.|.:
Zfish    77 VKA---KWKNLRDTYTRKKRLEQDGSRSGRAAKKKKQWKYMRVMDFLDPATEHRSGILDSKIEDD 138

  Fly   122 DDVESLKEQP----------KPQA------KRKRVST-------AAQRSAKTPRKRNSDQESNIE 163
            :..|....:|          .|:|      ||:|..|       .|.:.|| .|:::..|:..::
Zfish   139 EPDEDSGAEPASTSTGTSVTSPEAMRSSIVKRRRSETLELLEKYLATKDAK-DREKDEQQQDEVD 202

  Fly   164 -------PAIRN-PA-----IPSNINTVLGDLGCAKEDTATPEIAYIPQLPSDPP 205
                   ||:|. ||     :...|..:|.|     .:...|.   .||:.|..|
Zfish   203 LFLRSLAPALRRLPASKQSLVKLQIQKILHD-----AEFGQPS---FPQISSVSP 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng2NP_649837.1 MADF_DNA_bdg 21..113 CDD:287510 24/102 (24%)
BESS 216..250 CDD:281011
si:ch211-207i20.3XP_683419.5 MADF 35..122 CDD:214738 24/98 (24%)
BESS 199..233 CDD:308542 7/33 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.