DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng2 and jigr1

DIOPT Version :9

Sequence 1:NP_649837.1 Gene:hng2 / 41056 FlyBaseID:FBgn0037634 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster


Alignment Length:189 Identity:39/189 - (20%)
Similarity:72/189 - (38%) Gaps:51/189 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IIWERSHPNFHNRELRDEAWQQIGHELCSNFDDSSEPEKQ-------EIVKTLLKRWKNTRDS-- 85
            ::::||:..|.::......|:||.|:|  .:|.:|..|:.       .|.|..::...:|:.|  
  Fly    42 VLYDRSNKRFKDKLYVAHIWEQIAHKL--GYDATSIRERMTTLRNRYNIEKRRVENGLSTQSSQW 104

  Fly    86 -----------YLRVNR------LRQSGEEVARASYIYEKELSFLLNVKAESEDDVESLK-EQPK 132
                       ::|..|      :::..||..............:.::|.|.|||.|... ||..
  Fly   105 PLFESLQFLGDHIRPRRSFKNMSVKEEDEETYEVDDCRSDSNGHMNSIKDELEDDSEIFDCEQAL 169

  Fly   133 P-------------QAKRKRVSTAAQ--------RSAKTPRKRNSDQ-ESNIEPAIRNP 169
            |             :|.:.:.||..:        ..|::..:|:.:| |..|...|.||
  Fly   170 PVTTVLGIPLNNSDEANKSQRSTNGEMPNGKGYNHFAESYHRRHQNQPEYIISSPIVNP 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng2NP_649837.1 MADF_DNA_bdg 21..113 CDD:287510 19/108 (18%)
BESS 216..250 CDD:281011
jigr1NP_001097920.1 MADF 33..118 CDD:214738 15/77 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438471
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.