DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng2 and CG7745

DIOPT Version :10

Sequence 1:NP_649837.1 Gene:hng2 / 41056 FlyBaseID:FBgn0037634 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_610671.1 Gene:CG7745 / 36210 FlyBaseID:FBgn0033616 Length:506 Species:Drosophila melanogaster


Alignment Length:97 Identity:23/97 - (23%)
Similarity:36/97 - (37%) Gaps:22/97 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 TRLPLEWGKI---IEEVNTGRHASAMSGVTQTCRQLAHETRQVIENKEELLVFGGDHSCAIGTWS 107
            |:|.:...|:   |||||....|....       ...|...|:|:.|.:::.     :|.     
  Fly   290 TKLRVHQFKLMTEIEEVNEKLQAMRYD-------MEFHSKPQLIQMKPKIVA-----ACN----- 337

  Fly   108 GVATAMRPVGDIGLIWVDAHMDAHTPDTSDTG 139
              |..:.|:.|...|.|.|.:....|...:||
  Fly   338 --AIRLLPIRDFKQIRVPASLKIEIPHLFETG 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng2NP_649837.1 MADF 20..116 CDD:214738 15/72 (21%)
BESS 216..250 CDD:460758
CG7745NP_610671.1 MADF 5..96 CDD:214738
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.