DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng2 and CG11723

DIOPT Version :9

Sequence 1:NP_649837.1 Gene:hng2 / 41056 FlyBaseID:FBgn0037634 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001259906.1 Gene:CG11723 / 33388 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster


Alignment Length:291 Identity:58/291 - (19%)
Similarity:108/291 - (37%) Gaps:89/291 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YEFIDAVHKRSIIWERSHP-NFHNRELRDEAWQQIGHELCSNFDDSSEPEKQEIVKTLLKRWKNT 82
            |..|..|.||..:|:.:.. ::.|::...: |..:...:            |:.|....||:|..
  Fly     6 YRLIQEVSKRRCLWDTNMSISYRNQDAALQ-WASVAQIM------------QQDVSICKKRFKGM 57

  Fly    83 RDSY-LRVNRLRQSGEEVARASYIYEKELSFLLNVKAESEDDVESL-----------KEQPKPQA 135
            |||| ..|.:::|  :.:..:.:.|.:.|.|:..:     .|.|.|           .|||:...
  Fly    58 RDSYRAEVRKIQQ--KRIEMSHWPYFRSLEFMRQI-----FDPEGLVPFPPEPFVMNTEQPEVFE 115

  Fly   136 KRKRVSTAAQRSAKTPRKRNSDQESNIEPAI------RNPAIPSNINTVLGDL---------GCA 185
            ..:.|..|..        .:.|.:.:::..|      |.|::|.:..:..|.|         |..
  Fly   116 PTRLVDFAID--------LDLDNDDSVDFEIIEDIFKREPSVPQDSGSDKGSLIKPLDSSSSGAH 172

  Fly   186 KED-TATPEI-AYIPQ----LPSDPP---------------------------CSTNTAYLSADP 217
            :.| ..:|.: .::|:    ||..||                           .||....|..|.
  Fly   173 RSDQDLSPTLPIHLPRHQQFLPRPPPPSKRGRRRKTSPSNDVPLLNGYASQASKSTTEPDLKNDS 237

  Fly   218 DQAFFDTIKPHMQQMCADRKLDFQIEVLKIL 248
            |.:|..::.||::.:.|...|.|::|:.::|
  Fly   238 DLSFLMSMMPHVKSLSAISNLKFRMEMARVL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng2NP_649837.1 MADF_DNA_bdg 21..113 CDD:287510 20/93 (22%)
BESS 216..250 CDD:281011 10/33 (30%)
CG11723NP_001259906.1 MADF 7..91 CDD:214738 21/103 (20%)
BESS 236..270 CDD:281011 10/33 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438518
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.