DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng2 and CG4404

DIOPT Version :9

Sequence 1:NP_649837.1 Gene:hng2 / 41056 FlyBaseID:FBgn0037634 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster


Alignment Length:305 Identity:59/305 - (19%)
Similarity:111/305 - (36%) Gaps:88/305 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FIDAVHKRSIIWERSHPNFHNRELRDEAWQQIGHELCSNFDDSSEPEKQEIVKTLLKRWKNTRDS 85
            |:..|..:..:|..:||.:..:|....||||:.:::            ::.|:...:||:..|.|
  Fly    18 FVQFVENQPCLWNYTHPGYSKKEDVQRAWQQVANDI------------KDTVRNCRERWRTIRSS 70

  Fly    86 YLRVNRLRQSGEEVARASYIYEKELSFLL----------------------NVKAESEDDVESLK 128
            :||..:|.::.....:..|...|.|.||:                      ...|:.||:|.:.:
  Fly    71 FLRSLKLARTQTGRGKRKYYLSKYLQFLVPFTKSRSCHKQLPGMVLRKPGQAATAQQEDEVVAAE 135

  Fly   129 EQPK--------------PQAKRKRVSTAAQRSAKTPRK--------RNSDQESNIEPAIRNPAI 171
            |:.|              .:.:|.:.....|.:|..|.:        .:|:....:|..:...::
  Fly   136 EEAKVSDGEMPLDVQVSEEEHRRNQEQDREQPTACLPLRLHSIKVEHDSSNANQQLERMVSQQSL 200

  Fly   172 PSNINTVLG------DL---------GCAKEDTATPEIAYIPQLPSDPPCSTNTAYLSA------ 215
            .|.....||      ||         |..|..|.|.    .|..|..|| ...|:.||.      
  Fly   201 VSVPAAALGNHLGWSDLTQWFKGHGSGHHKLTTTTT----TPTSPPPPP-QPATSALSVFTGGPG 260

  Fly   216 ------DPDQAFFDTIKPHMQQMCADRKLDFQIEVLKILRNFKPN 254
                  |.|.:|..::.|::::|...:...|:.:|:.::.:...|
  Fly   261 GGGSQPDADYSFLISLHPYIKEMNGKQNRKFRQKVVGLIDDILDN 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng2NP_649837.1 MADF_DNA_bdg 21..113 CDD:287510 21/91 (23%)
BESS 216..250 CDD:281011 7/33 (21%)
CG4404NP_572838.2 MADF 17..103 CDD:214738 23/96 (24%)
BESS 267..301 CDD:281011 7/33 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469749
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.