DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng2 and CG12155

DIOPT Version :9

Sequence 1:NP_649837.1 Gene:hng2 / 41056 FlyBaseID:FBgn0037634 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_572403.1 Gene:CG12155 / 31682 FlyBaseID:FBgn0029957 Length:555 Species:Drosophila melanogaster


Alignment Length:235 Identity:51/235 - (21%)
Similarity:83/235 - (35%) Gaps:73/235 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IDAVHKRSIIWE-RSHPNFHNRELRDEAWQQIGHELCSNFDDSSEPEKQEIVKTLLKRWKNTRDS 85
            |:.|.:..:::. :..||...|......||::..::.:.:          .|:.:.::|||.||:
  Fly    25 INLVRQNPVLYNYKLQPNQRRRSDVLNGWQEVAQQIGNKY----------TVQEVRRKWKNLRDT 79

  Fly    86 YLRVNRLRQSGEEVARAS-YIYEKELSFLLNVKAESEDDVESLKEQPKPQAKRKRV--------- 140
            :.:. |||.......|.| :.|.|||.||..|            .|||.::.|...         
  Fly    80 FHQY-RLRTPKYIEGRLSKWRYAKELDFLSKV------------YQPKLKSHRNTQITYETSGVA 131

  Fly   141 ----------STAAQRSAKTPRKRNSDQESNIEPAIRNPAIPSNINTVLGDLGCAKEDTA----- 190
                      ||.....|....|::.|.:.               :.|:.|.|.:..|||     
  Fly   132 GAGGGIGGANSTTLPIGAMLHLKQHVDDDD---------------DEVMDDDGQSDHDTATLSSH 181

  Fly   191 --TPEIAYIPQLPSDPPCSTNTAYLSADPDQAFFDTIKPH 228
              |.:|.    |.||   ...|..|:|..:....||:..|
  Fly   182 HGTSQIT----LVSD---EAETFILTAYEEGVSDDTVSQH 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng2NP_649837.1 MADF_DNA_bdg 21..113 CDD:287510 22/92 (24%)
BESS 216..250 CDD:281011 3/13 (23%)
CG12155NP_572403.1 MADF 24..112 CDD:214738 25/109 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.