Sequence 1: | NP_649837.1 | Gene: | hng2 / 41056 | FlyBaseID: | FBgn0037634 | Length: | 254 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_492729.1 | Gene: | madf-10 / 190925 | WormBaseID: | WBGene00013717 | Length: | 234 | Species: | Caenorhabditis elegans |
Alignment Length: | 206 | Identity: | 40/206 - (19%) |
---|---|---|---|
Similarity: | 84/206 - (40%) | Gaps: | 53/206 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 VLRSAGSNLRYSMYEFIDAVHKRSIIWERSHPNFHNRELRDEAWQQIGHELCSNFDDSSEPEKQE 70
Fly 71 IV-------KTLLKRWKNTRDSYLRVNR---LRQSGEEVARASYIYEKELSFLLNVKAESEDDVE 125
Fly 126 SLKEQPK------------PQAKRKRVSTAAQ-------RSAKTPRKRNSDQES----NIEPAIR 167
Fly 168 NPAIPSNINTV 178 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
hng2 | NP_649837.1 | MADF_DNA_bdg | 21..113 | CDD:287510 | 20/101 (20%) |
BESS | 216..250 | CDD:281011 | |||
madf-10 | NP_492729.1 | MADF | 53..147 | CDD:214738 | 25/112 (22%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160156205 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0001895 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.930 |