DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hng2 and madf-2

DIOPT Version :9

Sequence 1:NP_649837.1 Gene:hng2 / 41056 FlyBaseID:FBgn0037634 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_492896.1 Gene:madf-2 / 173019 WormBaseID:WBGene00009461 Length:290 Species:Caenorhabditis elegans


Alignment Length:245 Identity:43/245 - (17%)
Similarity:87/245 - (35%) Gaps:79/245 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IDAVHKRSIIWERSHPNFHN-RELRDEAWQQIGHELCSNFDDSSEPEKQEIVK----TLLKRWKN 81
            |:|:..|.:||::::....| |.|:....:::..||.|.|        |..:|    .:..:|||
 Worm    13 INAIRNRPVIWDKNYFGESNYRTLKTSCLREVTSELNSMF--------QMPIKFTCEDVRSQWKN 69

  Fly    82 TRDSYLRVNRLRQSGEEVARA----SYIYEKELSFLLNVKAESEDDV------------------ 124
            .:|:::|..|....|:.:..|    ::.:.:.|:||...:|:...|.                  
 Worm    70 LKDTFVRKLRWVHEGKYMEDAMKEPTWKFYRMLTFLDEKEAKRLGDTCEHTYELAPNSTSCGQRA 134

  Fly   125 --------------ESLKEQPKPQAKRKRV------------------------STAAQRS---- 147
                          :....||.||..::.:                        ||:.:|.    
 Worm   135 QISYEPTSTEEKMFQMFNNQPPPQLSQQSMIDSSQIATCSNEPKMTSSSTFVTSSTSLKRGVHYS 199

  Fly   148 -AKTPRKRNSDQESNIEPAIRNPAIPSNINTVLGDLGCAKEDTATPEIAY 196
             .::|...:|..|..:|.....|....:....:.::...:..| ||.:|:
 Worm   200 PTRSPNGSSSGLEEELEDEDEQPGRKKSCRRQVSNIQPMQVIT-TPPVAH 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hng2NP_649837.1 MADF_DNA_bdg 21..113 CDD:287510 23/99 (23%)
BESS 216..250 CDD:281011
madf-2NP_492896.1 MADF 11..107 CDD:214738 25/101 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156201
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.