Sequence 1: | NP_649837.1 | Gene: | hng2 / 41056 | FlyBaseID: | FBgn0037634 | Length: | 254 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_492896.1 | Gene: | madf-2 / 173019 | WormBaseID: | WBGene00009461 | Length: | 290 | Species: | Caenorhabditis elegans |
Alignment Length: | 245 | Identity: | 43/245 - (17%) |
---|---|---|---|
Similarity: | 87/245 - (35%) | Gaps: | 79/245 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 IDAVHKRSIIWERSHPNFHN-RELRDEAWQQIGHELCSNFDDSSEPEKQEIVK----TLLKRWKN 81
Fly 82 TRDSYLRVNRLRQSGEEVARA----SYIYEKELSFLLNVKAESEDDV------------------ 124
Fly 125 --------------ESLKEQPKPQAKRKRV------------------------STAAQRS---- 147
Fly 148 -AKTPRKRNSDQESNIEPAIRNPAIPSNINTVLGDLGCAKEDTATPEIAY 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
hng2 | NP_649837.1 | MADF_DNA_bdg | 21..113 | CDD:287510 | 23/99 (23%) |
BESS | 216..250 | CDD:281011 | |||
madf-2 | NP_492896.1 | MADF | 11..107 | CDD:214738 | 25/101 (25%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160156201 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0001895 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.930 |