DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9839 and LOC100494255

DIOPT Version :9

Sequence 1:NP_001262388.1 Gene:CG9839 / 41055 FlyBaseID:FBgn0037633 Length:622 Species:Drosophila melanogaster
Sequence 2:XP_031758810.1 Gene:LOC100494255 / 100494255 -ID:- Length:485 Species:Xenopus tropicalis


Alignment Length:437 Identity:82/437 - (18%)
Similarity:147/437 - (33%) Gaps:151/437 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 EIFMALSLL-----MCDLKLEHLSDYWSTNMFYGLVGFSGKIPLERYQQLLHCLNFDAPQLQAGR 240
            |:...:|:|     ||.:..  :.|.||.|....::  ...:|.:|:..::..|.||....:|.|
 Frog   153 ELMAFISILFVRAIMCPIGA--IVDCWSENFLVPVI--KETMPRDRFISIMQHLRFDDKDTRAER 213

  Fly   241 AKV-KNSLLLDF---INERMEEIYICGQQLVLNE---------PITLWKGALRYQDELPNKFRTN 292
            .|. |.:.:.|.   .|:...|.:..|:.:.::|         |.|      :|....|:||   
 Frog   214 VKTDKFAAISDIWTRFNKNCAESFTPGEHMTIDEQLFPTKVRCPFT------QYIATKPDKF--- 269

  Fly   293 ALLLHMLTE-QSGLVVKILPEIVRKEDAPAWVRNSRQLVEHRNKIVLKLMEGY-HGGRTVYTSKF 355
            .:...:.|: ::..|....|.:   |..|:..:..| |.|:   :|:.|||.: ..||.|.|..|
 Frog   270 GIKFWISTDLETKYVCNASPYL---EKDPSRQKGER-LAEN---VVMNLMEPFLDDGRNVTTDNF 327

  Fly   356 YGSYGLAQELAKKSTYCTGLLDRNRYGNSKALVHQRLDSNSISTSYATSLMMAKWRRRAKSLYCF 420
            :.|..|:..|.::.|...|.::                               |.||....|   
 Frog   328 FTSLSLSHRLLRRKTTLLGTVN-------------------------------KVRRELPQL--- 358

  Fly   421 SSDCLAIYSKEMAMQKTNAKPKLIQELEFQLRPGNDGRHHLIHYQAACKELKANIKLTIF--LLN 483
            :.|...:||...|.::.                                      .:.:|  :|:
 Frog   359 AKDTARMYSIRAATRRW--------------------------------------PVAVFYNMLD 385

  Fly   484 ILVYNAYLLYFA----NGQNARVGHLKSYSEFRVIIIKSLLREEVTNEPVTSIQKPETYERSKNK 544
            :...|||:||.|    .|:..              :..|||.:|:            .::..::|
 Frog   386 LAAVNAYILYKACTGWTGKRR--------------LFLSLLAKEL------------RWQFMQHK 424

  Fly   545 PVPEPRLKTILHEPMLIQQNGKPAKKNCRYCHKGGMLQFSRYMCNTC 591
            .:...|.......|..:|......:::|.       ...||:.|.||
 Frog   425 EILAQRQAAAAAVPGTVQTTQCQVQESCN-------RNRSRFTCATC 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9839NP_001262388.1 DDE_Tnp_1_7 141..490 CDD:290555 62/330 (19%)
Tnp_zf-ribbon_2 570..602 CDD:290554 6/22 (27%)
LOC100494255XP_031758810.1 DDE_Tnp_1_7 120..392 CDD:372752 62/330 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1139412at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.