DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9839 and LOC100005965

DIOPT Version :9

Sequence 1:NP_001262388.1 Gene:CG9839 / 41055 FlyBaseID:FBgn0037633 Length:622 Species:Drosophila melanogaster
Sequence 2:XP_001344859.1 Gene:LOC100005965 / 100005965 -ID:- Length:132 Species:Danio rerio


Alignment Length:117 Identity:35/117 - (29%)
Similarity:50/117 - (42%) Gaps:29/117 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   515 IIKSLLREEVTNEPVTSIQKP--------ETYERSKNKPVPE----PRLKTIL-----HEPMLIQ 562
            ::|....||.|.:..||||..        |.|..|:   .|.    |.|:|.|     |.|.|:.
Zfish    16 LVKQEDPEEQTGKETTSIQIKVNVMKGLLEEYSTSR---CPSTAGCPALETPLRLTDRHFPSLVP 77

  Fly   563 Q---NGKPAKKNCRYC----HKGGMLQFSRYMCNTCPDKPGLCQEPCFLLWH 607
            |   .|...:::|:.|    .|....:.::|||..| :.| ||..|||..:|
Zfish    78 QTASQGSRTRRHCKVCLSGTRKDKRRRLTKYMCLQC-NTP-LCVVPCFEEYH 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9839NP_001262388.1 DDE_Tnp_1_7 141..490 CDD:290555
Tnp_zf-ribbon_2 570..602 CDD:290554 10/35 (29%)
LOC100005965XP_001344859.1 Tnp_zf-ribbon_2 88..122 CDD:290554 10/35 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1139412at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.