DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCT7 and TCM62

DIOPT Version :9

Sequence 1:NP_649835.1 Gene:CCT7 / 41054 FlyBaseID:FBgn0037632 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_009600.2 Gene:TCM62 / 852332 SGDID:S000000248 Length:572 Species:Saccharomyces cerevisiae


Alignment Length:324 Identity:69/324 - (21%)
Similarity:118/324 - (36%) Gaps:74/324 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLKEGTDSSQGKPQLVSNINACQSIV-------------DAVRTTLGPRGMDKLIVDAHGK--A 55
            :::|...|......||..:.:..|||.             |.||...|.:..|::.|....|  |
Yeast   166 IIVKSQNDVDALVEQLTMSSSDSQSIKRVLKAINYELFSDDIVRVINGNKTYDEVDVSKGWKYPA 230

  Fly    56 TISNDGATIMKLLEIIHPAAKTLVDIAKSQDAEVGDGTTSVVLLAGEFLKQVKPFVEEGVHPRVI 120
            .|.:.....::.||:   ..|.||.|.|.....:.|||          |:.....:....:.|  
Yeast   231 GILDSNEAYLRSLEL---PTKKLVSIDKDMLVLMYDGT----------LRDANKILPTITYAR-- 280

  Fly   121 IKAIRKALQLCM------EKINEMAVQIVEQSKD--QQRALLEKCAATAMSSKLIHQQKDF--FS 175
              .:||::.|.:      :.:..:.:......::  :.|.::.|.:..|.:.....:..||  |.
Yeast   281 --KLRKSVLLIVNGDCTGDALTSVTINNNRNKRENNESRIVVLKYSKKANNDLAPQENLDFIKFL 343

  Fly   176 RIV--VDAVLS--LDELLPLNMIGIKKVTGGSLEESQLVSGVAFKKTFSYAGFE------MAPKS 230
            |:.  .|::.|  ...|:|..|...|..  ||:|..:..:|.|    |.|...:      ..|||
Yeast   344 RLPCGYDSIYSPEYSPLVPSKMCADKYY--GSIESIKATTGEA----FLYNSIDAEAIPNKVPKS 402

  Fly   231 YDNCKIALL---NIELELKAERDNAEIRVDNVKEYQKVVDAEWQILYNKLAKIHESGANVVLSK 291
            :....:.|.   :.|:|:...| ||   :||...         .:|.:.|||....|..:.|.|
Yeast   403 FLQNTVTLSIGGHNEIEIDRRR-NA---IDNCLN---------NVLCHGLAKGFIPGYGISLLK 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCT7NP_649835.1 chap_CCT_eta 2..524 CDD:274086 69/324 (21%)
TCP1_eta 4..524 CDD:239456 69/324 (21%)
TCM62NP_009600.2 PTZ00114 124..492 CDD:185455 69/324 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0459
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.