DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir85a and Ir87a

DIOPT Version :9

Sequence 1:NP_649833.1 Gene:Ir85a / 41052 FlyBaseID:FBgn0037630 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster


Alignment Length:317 Identity:59/317 - (18%)
Similarity:105/317 - (33%) Gaps:107/317 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 ELSLIRKKSAAKHRSHVFLLVRDADTVSDAWMRASFRQFWKIWLLNIVILYWRDGRLNAYR---- 168
            ||:....::..:|....|:...:||        |.|  ...|:::...::.|...|::.::    
  Fly   476 ELTWCVARAKRRHGFFNFVATFNAD--------AGF--LIGIFVVTCSLVVWLAQRVSGFQLRNL 530

  Fly   169 --YNP-------FMDNYLIPVDNKPNEVPTLEQLFPKT------IPNMQRKPL-------RMCIY 211
              |.|       .:.|..||..:.|   .||.|||..:      ..|..:..|       |....
  Fly   531 NGYFPTCLRVLGILLNQAIPAQDFP---ITLRQLFALSFLMGFFFSNTYQSFLISTLTTPRSSYQ 592

  Fly   212 KDDVRAIFWRQGTILGT---------DGLLAAYVAERL-----------------NATMMITRPH 250
            ...::.|:..:.|::||         ||.:..|:.|:.                 :..:.::|.|
  Fly   593 IHTLQEIYSNKMTVMGTSEHVRHLNKDGEIFKYIREKFQMCYNLVDCLNDAAQNEHIAVAVSRQH 657

  Fly   251 SYNNHNLSSD--ICFLEVAKEYVDVAMNIRFLVPDTF---------------------------- 285
            |:.|..:..|  .||......||.:   :..|:|..:                            
  Fly   658 SFYNPRIQRDRLYCFDRRESLYVYL---VTMLLPKKYHLLHQINPVIQHIIESGHMQKWARDLDM 719

  Fly   286 RKQAESTVSHTRDDLCVIVP-KAKTAPTFWNIFRSFGSLVWALILVSVLVANVFCYI 341
            |:.....::..|:|     | ||.|...|.......|.|   |::.|.:.|...||:
  Fly   720 RRMIHEEITRVRED-----PFKALTFDQFRGAIAFSGGL---LLVASCVFAFELCYV 768

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir85aNP_649833.1 None
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.