DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir85a and gria4a

DIOPT Version :9

Sequence 1:NP_649833.1 Gene:Ir85a / 41052 FlyBaseID:FBgn0037630 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_999971.1 Gene:gria4a / 407735 ZFINID:ZDB-GENE-020125-7 Length:898 Species:Danio rerio


Alignment Length:351 Identity:61/351 - (17%)
Similarity:116/351 - (33%) Gaps:103/351 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 LCVIVPK-AKTAPTFWNIFRSFGSLVWALILVSVLVANVFCYILKSEVGRV---------PMQLF 354
            :.:::.| .|:.|..::........:|..|:.:.:..:|..::    |.|.         |.:..
Zfish   516 ISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFL----VSRFSPYEWHTEEPEEGS 576

  Fly   355 AGALTMPMTQIPPNHSIRLFLIF------------------------------WLYFGLLICSAF 389
            .|    |.:..|||.    |.||                              |.:|.|:|.|::
Zfish   577 DG----PPSDQPPNE----FGIFNSLWFSLGAFMQQGCDFTPRSLSGRIVGGVWWFFTLIIISSY 633

  Fly   390 KGNLTSMMVFQPYLPDINQLGALARSHYHIIIRPRHVKHIQHFLTLGHKHESRIREQMLEVSDTQ 454
            ..||.:.:..:..:..|.....||:               |..:..| ..:|...::....|...
Zfish   634 TANLAAFLTVERMVSPIESAEDLAK---------------QTEIAYG-TLDSGSTKEFFRRSKIA 682

  Fly   455 MYEMMRNNDIRFAYLEKYHIARFQVN-----SRVHMHLGRPLFHLMNSCL-------VPFHAVYI 507
            :||.|      ::|::......|...     :||....|:..| |:.|.:       .|...:.:
Zfish   683 VYEKM------WSYMKSAEPTVFTKTTAEGVARVRKSKGKYAF-LLESTMNEYTEQRKPCDTMKV 740

  Fly   508 ------------VPYGSPYLGFLDSLIRSSHEFGFERYWDRIMNSAFIKSGVKVVNRRRGSGNDE 560
                        .|.||.....::..:....|.|   ..|::.|..:...| :...:..||.:..
Zfish   741 GGNLDSKGYGVATPKGSQLGTPVNLAVLKLSEAG---VLDKLKNKWWYDKG-ECGPKDSGSKDKS 801

  Fly   561 PVVLKLQHFHAVFALWLVGIGMACIV 586
            ...|.|.:...||.:.:.|:|:|.:|
Zfish   802 SQALSLSNVAGVFYILVGGLGLAMLV 827

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir85aNP_649833.1 None
gria4aNP_999971.1 PBP1_iGluR_AMPA_GluR4 23..393 CDD:107383
ANF_receptor 34..375 CDD:279440
PBP2_iGluR_AMPA_GluR4 408..790 CDD:270445 51/312 (16%)
Lig_chan 540..821 CDD:278489 54/319 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591670
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.