DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir85a and Ir75c

DIOPT Version :9

Sequence 1:NP_649833.1 Gene:Ir85a / 41052 FlyBaseID:FBgn0037630 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_649013.3 Gene:Ir75c / 39983 FlyBaseID:FBgn0261401 Length:623 Species:Drosophila melanogaster


Alignment Length:240 Identity:53/240 - (22%)
Similarity:86/240 - (35%) Gaps:83/240 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 WLYFGLLICSAFKGNLTSMMVFQ--------PYLPDINQLGALARSHYHIIIRPRHVKHIQH--- 431
            |..:.|::.:..:.||:::|||.        |.:..:||.|..  |.|..:..|.::.::..   
  Fly     4 WPLYRLIVFNLLEINLSNLMVFHCWSIKEAFPLVEMLNQNGIF--SQYIDVQNPDNLANVHKEYL 66

  Fly   432 ---------FLTLG---------HKHESRIREQML------EVSD----TQMYE----------- 457
                     ||.||         ....:|:..|.|      |..:    ||::|           
  Fly    67 DSDLVRLGVFLDLGCDKAELVTNQSSRARLYNQNLHWLLYDEAGNFTKLTQLFEGANLSLNADVT 131

  Fly   458 -MMRNNDIRFAYLEKY----HIA---------RFQVNSRVH---------MHLGRPLFHLMNSCL 499
             :.|.::.||...:.|    |:.         ..|.| |.|         :||...|.|.|:...
  Fly   132 YVSREDEERFILHDVYNKGSHLGGKLNITVDQTLQCN-RSHCQVKEYLSELHLRPRLQHRMDLSS 195

  Fly   500 VPFH---AVYIVPYGS---PYLGFLDSLIRSSHEFGFERYWDRIM 538
            |.|.   .|.::|..|   ..|.||:| .|.||.....|..:|::
  Fly   196 VTFRLAALVSVLPINSSEEELLEFLNS-DRDSHMDSISRIGNRLI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir85aNP_649833.1 None
Ir75cNP_649013.3 Lig_chan 328..553 CDD:306551
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462770
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.